Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168P9C1

Protein Details
Accession A0A168P9C1    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
166-191IKQTLNDKKSKKSMKRKLQEDQDESLHydrophilic
NLS Segment(s)
PositionSequence
175-181SKKSMKR
Subcellular Location(s) mito 18, cyto 6, nucl 2
Family & Domain DBs
Amino Acid Sequences MTNGSNVWVAYIRRSVLNRIKRGEKRIATGDGEDIIFKLDAKLVLLYDHAEYPVCAAEFAPYAGLKRIKTDRSKLLVEAKVICDKIMNLELSEEQAALLSVVNVQVVGLETSTVSVKLVDNHLYAANTISSYTLPSTVSQLKQHCKDVIGQIFDLKYYTLNTADIIKQTLNDKKSKKSMKRKLQEDQDESLPPLTAKPAPTWRHKARKQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.4
4 0.49
5 0.52
6 0.56
7 0.65
8 0.67
9 0.72
10 0.73
11 0.68
12 0.64
13 0.62
14 0.6
15 0.53
16 0.47
17 0.41
18 0.32
19 0.28
20 0.22
21 0.16
22 0.13
23 0.1
24 0.09
25 0.08
26 0.08
27 0.08
28 0.09
29 0.1
30 0.08
31 0.09
32 0.09
33 0.1
34 0.1
35 0.1
36 0.09
37 0.09
38 0.08
39 0.09
40 0.1
41 0.09
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.07
49 0.08
50 0.12
51 0.16
52 0.15
53 0.2
54 0.25
55 0.31
56 0.37
57 0.42
58 0.46
59 0.48
60 0.49
61 0.47
62 0.49
63 0.44
64 0.4
65 0.36
66 0.3
67 0.29
68 0.27
69 0.24
70 0.16
71 0.14
72 0.14
73 0.15
74 0.13
75 0.09
76 0.1
77 0.1
78 0.11
79 0.11
80 0.08
81 0.06
82 0.05
83 0.05
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.09
106 0.1
107 0.1
108 0.11
109 0.12
110 0.11
111 0.11
112 0.1
113 0.08
114 0.07
115 0.07
116 0.06
117 0.05
118 0.06
119 0.07
120 0.07
121 0.07
122 0.08
123 0.12
124 0.15
125 0.17
126 0.22
127 0.27
128 0.34
129 0.37
130 0.4
131 0.38
132 0.34
133 0.36
134 0.38
135 0.37
136 0.32
137 0.29
138 0.27
139 0.26
140 0.25
141 0.22
142 0.15
143 0.1
144 0.09
145 0.11
146 0.1
147 0.1
148 0.11
149 0.13
150 0.15
151 0.15
152 0.15
153 0.14
154 0.14
155 0.2
156 0.26
157 0.27
158 0.34
159 0.37
160 0.43
161 0.53
162 0.62
163 0.67
164 0.71
165 0.78
166 0.81
167 0.87
168 0.88
169 0.88
170 0.88
171 0.88
172 0.82
173 0.75
174 0.68
175 0.6
176 0.54
177 0.45
178 0.34
179 0.24
180 0.2
181 0.19
182 0.18
183 0.18
184 0.23
185 0.31
186 0.37
187 0.46
188 0.55
189 0.62
190 0.7