Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J5JNR5

Protein Details
Accession J5JNR5    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-60LKSFRTKQKLAKSQKQNRPVPQHydrophilic
65-86RTNNSVRYNAKRRHWRKTKLGIHydrophilic
NLS Segment(s)
PositionSequence
75-82KRRHWRKT
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MRQDETYRDLFFAISRPTKRTSSDDTLPPLLTHLALQSLKSFRTKQKLAKSQKQNRPVPQWIRLRTNNSVRYNAKRRHWRKTKLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.3
4 0.34
5 0.37
6 0.4
7 0.41
8 0.43
9 0.42
10 0.45
11 0.46
12 0.46
13 0.45
14 0.42
15 0.36
16 0.29
17 0.22
18 0.17
19 0.13
20 0.08
21 0.1
22 0.09
23 0.1
24 0.12
25 0.13
26 0.14
27 0.16
28 0.19
29 0.2
30 0.28
31 0.32
32 0.37
33 0.45
34 0.54
35 0.6
36 0.67
37 0.74
38 0.77
39 0.81
40 0.84
41 0.81
42 0.79
43 0.77
44 0.77
45 0.71
46 0.7
47 0.7
48 0.66
49 0.66
50 0.65
51 0.63
52 0.62
53 0.66
54 0.66
55 0.61
56 0.64
57 0.61
58 0.65
59 0.69
60 0.69
61 0.7
62 0.72
63 0.76
64 0.79
65 0.84
66 0.84