Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168LMV4

Protein Details
Accession A0A168LMV4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-73DVVMSFRKSKDRKKEKEKEKKTFNPFALHydrophilic
NLS Segment(s)
PositionSequence
52-66RKSKDRKKEKEKEKK
Subcellular Location(s) mito 11, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008606  EIF4EBP  
Gene Ontology GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0045947  P:negative regulation of translational initiation  
Pfam View protein in Pfam  
PF05456  eIF_4EBP  
Amino Acid Sequences MAVDQGNRVNYDRTTLLALAGSPFAKVPPVKMAFIPGVTRTPNQSDVVMSFRKSKDRKKEKEKEKKTFNPFALLGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.14
5 0.14
6 0.11
7 0.11
8 0.1
9 0.07
10 0.07
11 0.07
12 0.1
13 0.1
14 0.11
15 0.17
16 0.19
17 0.2
18 0.2
19 0.22
20 0.2
21 0.2
22 0.2
23 0.13
24 0.13
25 0.13
26 0.14
27 0.13
28 0.15
29 0.17
30 0.17
31 0.16
32 0.14
33 0.14
34 0.18
35 0.18
36 0.17
37 0.2
38 0.2
39 0.29
40 0.35
41 0.43
42 0.5
43 0.59
44 0.69
45 0.75
46 0.84
47 0.86
48 0.92
49 0.93
50 0.92
51 0.92
52 0.92
53 0.9
54 0.88
55 0.79
56 0.74
57 0.64
58 0.56