FuNGI

A0A168J056

Protein Details

Accession

A0A168J056

Localization Confidence

High

Confidence Score

15.3

NoLS Segment(s)

Position	Sequence	Protein Nature
453-479	GQQTAANTSPNKKKKKNNKKKKVALTQ	Hydrophilic

NLS Segment(s)

Position	Sequence
463-474	NKKKKKNNKKKK

Subcellular Location(s)

nucl 19, cyto 5, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR001678 MeTrfase_RsmB/NOP2 IPR023267 RCMT IPR029063 SAM-dependent_MTases_sf
Gene Ontology	GO:0003723 F:RNA binding GO:0008173 F:RNA methyltransferase activity GO:0008757 F:S-adenosylmethionine-dependent methyltransferase activity
Pfam	View protein in Pfam PF01189 Methyltr_RsmB-F
PROSITE	View protein in PROSITE PS51686 SAM_MT_RSMB_NOP
CDD	cd02440 AdoMet_MTases

Amino Acid Sequences

MNFYQHAGRILDKLARHEGTIKGLIIGDPKVWDKKKMYALVCETLKYKQVLNELIDASKICEVEKKLKRSLALVLIHDLLFTKRGITVRNDVPLKQCVMRHQARLKSELIKIKVKRGATSDEDLVSQKVKDAVLIPRYARVNEHKLTVQKAIKSFQNEGYTLVDCPEDLRELKLKEFCVDRHLHDMLIFHQKTDFHAHPLYVSGNIILQDKASCFPAHVCQAPQGAHAIDACAAPGNKTSHLSALMKNTGKIWAFDLDSRRLELLKKLTNKAGCKNITPVHGSFLETNPEDAQFANVEYLLLDPSCSGSGIISRLDHLVDDEDEKENANGQTQEERLKNLSDFQISIIQHAMKFPKAKRIVYSTCSIHPDENEHVVKAILKDNPEFELAKRDSVLPTWERRGIPAEIDGNKDLADRLVRTIPAEDLTNGFFVSCFIRKSGASSASNKRPLEQGQQTAANTSPNKKKKKNNKKKKVALTQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.35
2	0.34
3	0.34
4	0.35
5	0.35
6	0.36
7	0.37
8	0.32
9	0.25
10	0.25
11	0.24
12	0.23
13	0.22
14	0.17
15	0.16
16	0.21
17	0.29
18	0.31
19	0.37
20	0.38
21	0.45
22	0.53
23	0.58
24	0.57
25	0.56
26	0.6
27	0.6
28	0.58
29	0.52
30	0.45
31	0.39
32	0.41
33	0.33
34	0.3
35	0.27
36	0.31
37	0.34
38	0.34
39	0.37
40	0.33
41	0.32
42	0.31
43	0.26
44	0.22
45	0.19
46	0.17
47	0.13
48	0.17
49	0.2
50	0.3
51	0.38
52	0.43
53	0.47
54	0.5
55	0.51
56	0.49
57	0.5
58	0.48
59	0.44
60	0.38
61	0.35
62	0.33
63	0.31
64	0.28
65	0.23
66	0.16
67	0.13
68	0.12
69	0.1
70	0.11
71	0.14
72	0.17
73	0.21
74	0.28
75	0.3
76	0.38
77	0.4
78	0.38
79	0.41
80	0.41
81	0.39
82	0.36
83	0.34
84	0.32
85	0.39
86	0.43
87	0.47
88	0.52
89	0.55
90	0.54
91	0.56
92	0.53
93	0.49
94	0.5
95	0.49
96	0.46
97	0.48
98	0.47
99	0.52
100	0.53
101	0.49
102	0.46
103	0.42
104	0.43
105	0.39
106	0.41
107	0.35
108	0.3
109	0.3
110	0.28
111	0.25
112	0.21
113	0.16
114	0.13
115	0.13
116	0.12
117	0.12
118	0.14
119	0.2
120	0.22
121	0.25
122	0.24
123	0.27
124	0.29
125	0.28
126	0.29
127	0.3
128	0.33
129	0.31
130	0.34
131	0.33
132	0.35
133	0.37
134	0.4
135	0.37
136	0.34
137	0.35
138	0.35
139	0.35
140	0.36
141	0.36
142	0.34
143	0.34
144	0.31
145	0.3
146	0.3
147	0.26
148	0.22
149	0.2
150	0.14
151	0.1
152	0.11
153	0.1
154	0.09
155	0.09
156	0.11
157	0.15
158	0.17
159	0.2
160	0.23
161	0.22
162	0.23
163	0.25
164	0.23
165	0.25
166	0.26
167	0.25
168	0.28
169	0.27
170	0.25
171	0.23
172	0.23
173	0.2
174	0.27
175	0.25
176	0.19
177	0.2
178	0.21
179	0.22
180	0.28
181	0.25
182	0.19
183	0.2
184	0.2
185	0.19
186	0.2
187	0.18
188	0.12
189	0.11
190	0.07
191	0.07
192	0.08
193	0.09
194	0.07
195	0.07
196	0.07
197	0.08
198	0.08
199	0.09
200	0.08
201	0.08
202	0.09
203	0.12
204	0.14
205	0.15
206	0.15
207	0.15
208	0.18
209	0.18
210	0.17
211	0.15
212	0.12
213	0.11
214	0.11
215	0.08
216	0.07
217	0.06
218	0.06
219	0.06
220	0.06
221	0.06
222	0.09
223	0.1
224	0.1
225	0.12
226	0.12
227	0.12
228	0.15
229	0.16
230	0.15
231	0.17
232	0.22
233	0.21
234	0.21
235	0.2
236	0.21
237	0.19
238	0.18
239	0.16
240	0.13
241	0.13
242	0.16
243	0.19
244	0.19
245	0.19
246	0.19
247	0.18
248	0.17
249	0.17
250	0.18
251	0.21
252	0.23
253	0.27
254	0.29
255	0.33
256	0.38
257	0.4
258	0.41
259	0.43
260	0.39
261	0.36
262	0.39
263	0.37
264	0.35
265	0.35
266	0.3
267	0.25
268	0.24
269	0.24
270	0.2
271	0.18
272	0.19
273	0.16
274	0.16
275	0.14
276	0.13
277	0.12
278	0.11
279	0.11
280	0.07
281	0.07
282	0.07
283	0.06
284	0.06
285	0.05
286	0.06
287	0.05
288	0.05
289	0.04
290	0.04
291	0.05
292	0.05
293	0.05
294	0.05
295	0.05
296	0.06
297	0.08
298	0.09
299	0.08
300	0.09
301	0.09
302	0.09
303	0.09
304	0.08
305	0.09
306	0.08
307	0.09
308	0.1
309	0.11
310	0.11
311	0.12
312	0.11
313	0.13
314	0.12
315	0.13
316	0.13
317	0.13
318	0.16
319	0.17
320	0.23
321	0.21
322	0.23
323	0.22
324	0.23
325	0.23
326	0.23
327	0.24
328	0.19
329	0.19
330	0.18
331	0.23
332	0.21
333	0.22
334	0.2
335	0.19
336	0.17
337	0.2
338	0.2
339	0.18
340	0.24
341	0.25
342	0.33
343	0.38
344	0.4
345	0.42
346	0.48
347	0.49
348	0.46
349	0.51
350	0.43
351	0.42
352	0.43
353	0.4
354	0.34
355	0.29
356	0.3
357	0.28
358	0.32
359	0.29
360	0.26
361	0.25
362	0.23
363	0.24
364	0.21
365	0.23
366	0.18
367	0.2
368	0.21
369	0.22
370	0.24
371	0.24
372	0.23
373	0.19
374	0.26
375	0.25
376	0.25
377	0.24
378	0.24
379	0.23
380	0.23
381	0.29
382	0.24
383	0.29
384	0.33
385	0.38
386	0.36
387	0.37
388	0.4
389	0.35
390	0.32
391	0.31
392	0.32
393	0.29
394	0.33
395	0.31
396	0.27
397	0.26
398	0.24
399	0.2
400	0.16
401	0.16
402	0.13
403	0.16
404	0.19
405	0.2
406	0.21
407	0.22
408	0.21
409	0.2
410	0.2
411	0.18
412	0.16
413	0.16
414	0.16
415	0.14
416	0.12
417	0.11
418	0.1
419	0.14
420	0.15
421	0.15
422	0.15
423	0.18
424	0.19
425	0.23
426	0.29
427	0.32
428	0.34
429	0.4
430	0.49
431	0.56
432	0.64
433	0.6
434	0.54
435	0.53
436	0.53
437	0.56
438	0.54
439	0.51
440	0.49
441	0.53
442	0.52
443	0.48
444	0.44
445	0.41
446	0.37
447	0.39
448	0.45
449	0.49
450	0.59
451	0.66
452	0.76
453	0.8
454	0.88
455	0.91
456	0.92
457	0.94
458	0.95
459	0.96

A0A168J056

3D AlphaFold-predicted Structure Viewer