Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168GIN5

Protein Details
Accession A0A168GIN5   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
87-113LLDEKKQKQKTTKPVNRQYHRKQSREAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSTLVRSSRPLLQHNLPRASYLHSCAIVRNVASESTTAASTPSTTTQRKPSSAPKGTVLKGIQYLKDKQDPVALDDSEYPEWLWDLLDEKKQKQKTTKPVNRQYHRKQSREAIKAMNFMKDKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.59
4 0.53
5 0.49
6 0.45
7 0.44
8 0.38
9 0.34
10 0.29
11 0.25
12 0.25
13 0.25
14 0.26
15 0.22
16 0.2
17 0.17
18 0.15
19 0.13
20 0.13
21 0.12
22 0.11
23 0.1
24 0.1
25 0.08
26 0.08
27 0.07
28 0.07
29 0.09
30 0.11
31 0.16
32 0.18
33 0.21
34 0.3
35 0.33
36 0.35
37 0.37
38 0.43
39 0.47
40 0.5
41 0.49
42 0.45
43 0.46
44 0.45
45 0.45
46 0.36
47 0.27
48 0.27
49 0.26
50 0.23
51 0.22
52 0.24
53 0.23
54 0.28
55 0.27
56 0.23
57 0.26
58 0.24
59 0.23
60 0.24
61 0.2
62 0.16
63 0.17
64 0.19
65 0.16
66 0.15
67 0.12
68 0.09
69 0.09
70 0.08
71 0.07
72 0.05
73 0.08
74 0.1
75 0.17
76 0.2
77 0.24
78 0.32
79 0.37
80 0.43
81 0.5
82 0.57
83 0.61
84 0.7
85 0.76
86 0.78
87 0.84
88 0.89
89 0.89
90 0.9
91 0.9
92 0.9
93 0.89
94 0.83
95 0.79
96 0.78
97 0.79
98 0.75
99 0.69
100 0.66
101 0.6
102 0.62
103 0.57
104 0.55
105 0.48