Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167XMR2

Protein Details
Accession A0A167XMR2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-61LPPVCRARIEPRIRLRFRRHRRDPAPDKRLRQASHBasic
NLS Segment(s)
PositionSequence
37-56PRIRLRFRRHRRDPAPDKRL
177-188KPARTKLRKWWK
Subcellular Location(s) mito 14, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046896  Cup1-like_N  
Pfam View protein in Pfam  
PF20263  LYRM2-like  
Amino Acid Sequences MSAPMGLPQPRNAVHIYRHLLREASYLPPVCRARIEPRIRLRFRRHRRDPAPDKRLRQASHDLRFLRAANHGDMTRMRKIVQLAFGRIGWRYHELMRRLRQPDQPDSAAQLEADLRRVRAADDWLDRWDTEKLLAFARSQSQYKLRDSPRPQASAKRLDPAEAVPATNAWGRPFAEKPARTKLRKWWKSLARRSLPPVPQGEWELLKQLATGQAGTAGHVPARRAMVQATQATHASLASTPAPEDEWEWEKYATRPIRSVERSRARRFCIARGLGPPPPDSPYEGPAIGIHRYTARFWRRLYADVWRMTATMERKPGQAQRAWDITWGGVPLRPASPLAGKYESFEGVDSTGMPLNQPEETGLATTKGAQRRKDKKDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.44
4 0.44
5 0.45
6 0.44
7 0.42
8 0.38
9 0.38
10 0.31
11 0.29
12 0.29
13 0.3
14 0.28
15 0.36
16 0.37
17 0.34
18 0.35
19 0.36
20 0.38
21 0.46
22 0.53
23 0.54
24 0.63
25 0.72
26 0.76
27 0.8
28 0.82
29 0.83
30 0.86
31 0.88
32 0.88
33 0.88
34 0.9
35 0.91
36 0.92
37 0.92
38 0.91
39 0.88
40 0.84
41 0.82
42 0.82
43 0.72
44 0.68
45 0.67
46 0.66
47 0.65
48 0.67
49 0.59
50 0.52
51 0.54
52 0.48
53 0.39
54 0.35
55 0.31
56 0.26
57 0.28
58 0.26
59 0.25
60 0.29
61 0.32
62 0.31
63 0.29
64 0.27
65 0.27
66 0.3
67 0.31
68 0.35
69 0.34
70 0.32
71 0.33
72 0.33
73 0.31
74 0.29
75 0.26
76 0.21
77 0.2
78 0.2
79 0.24
80 0.29
81 0.34
82 0.41
83 0.48
84 0.54
85 0.55
86 0.58
87 0.59
88 0.59
89 0.6
90 0.57
91 0.52
92 0.44
93 0.43
94 0.38
95 0.33
96 0.25
97 0.19
98 0.16
99 0.14
100 0.17
101 0.15
102 0.13
103 0.14
104 0.14
105 0.14
106 0.14
107 0.17
108 0.18
109 0.2
110 0.22
111 0.23
112 0.24
113 0.23
114 0.23
115 0.21
116 0.16
117 0.14
118 0.14
119 0.14
120 0.14
121 0.16
122 0.14
123 0.14
124 0.19
125 0.2
126 0.19
127 0.21
128 0.25
129 0.28
130 0.32
131 0.39
132 0.38
133 0.45
134 0.48
135 0.55
136 0.54
137 0.55
138 0.53
139 0.53
140 0.55
141 0.55
142 0.51
143 0.47
144 0.42
145 0.38
146 0.37
147 0.29
148 0.27
149 0.19
150 0.17
151 0.11
152 0.11
153 0.12
154 0.12
155 0.12
156 0.08
157 0.1
158 0.1
159 0.13
160 0.14
161 0.18
162 0.24
163 0.26
164 0.3
165 0.38
166 0.46
167 0.46
168 0.49
169 0.54
170 0.57
171 0.61
172 0.63
173 0.62
174 0.63
175 0.71
176 0.76
177 0.76
178 0.7
179 0.66
180 0.66
181 0.64
182 0.58
183 0.51
184 0.45
185 0.36
186 0.32
187 0.3
188 0.27
189 0.2
190 0.17
191 0.15
192 0.12
193 0.11
194 0.09
195 0.09
196 0.09
197 0.08
198 0.08
199 0.06
200 0.08
201 0.08
202 0.09
203 0.09
204 0.07
205 0.08
206 0.1
207 0.1
208 0.1
209 0.12
210 0.12
211 0.11
212 0.12
213 0.13
214 0.17
215 0.18
216 0.18
217 0.17
218 0.17
219 0.16
220 0.16
221 0.13
222 0.09
223 0.07
224 0.08
225 0.07
226 0.07
227 0.07
228 0.07
229 0.08
230 0.08
231 0.09
232 0.11
233 0.13
234 0.14
235 0.16
236 0.16
237 0.17
238 0.18
239 0.26
240 0.27
241 0.25
242 0.27
243 0.28
244 0.37
245 0.41
246 0.46
247 0.48
248 0.54
249 0.61
250 0.67
251 0.71
252 0.66
253 0.69
254 0.65
255 0.6
256 0.59
257 0.53
258 0.48
259 0.46
260 0.45
261 0.4
262 0.39
263 0.36
264 0.28
265 0.27
266 0.25
267 0.25
268 0.23
269 0.22
270 0.23
271 0.21
272 0.2
273 0.19
274 0.21
275 0.17
276 0.15
277 0.14
278 0.14
279 0.16
280 0.17
281 0.25
282 0.3
283 0.34
284 0.35
285 0.43
286 0.42
287 0.44
288 0.44
289 0.45
290 0.45
291 0.42
292 0.43
293 0.36
294 0.33
295 0.31
296 0.34
297 0.27
298 0.25
299 0.29
300 0.29
301 0.3
302 0.35
303 0.41
304 0.42
305 0.43
306 0.41
307 0.41
308 0.43
309 0.42
310 0.38
311 0.33
312 0.27
313 0.24
314 0.21
315 0.15
316 0.13
317 0.13
318 0.14
319 0.14
320 0.15
321 0.14
322 0.16
323 0.2
324 0.21
325 0.25
326 0.27
327 0.26
328 0.27
329 0.3
330 0.28
331 0.23
332 0.22
333 0.17
334 0.14
335 0.14
336 0.12
337 0.11
338 0.12
339 0.11
340 0.11
341 0.12
342 0.13
343 0.13
344 0.13
345 0.12
346 0.11
347 0.12
348 0.13
349 0.13
350 0.12
351 0.12
352 0.16
353 0.22
354 0.29
355 0.35
356 0.41
357 0.51
358 0.61