Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167VLS1

Protein Details
Accession A0A167VLS1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
135-170TSTVRWCKKCDAPKPRRAHHCRHCRRCIPKMDHHCPBasic
NLS Segment(s)
Subcellular Location(s) plas 12, extr 8, mito 3, E.R. 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001594  Palmitoyltrfase_DHHC  
IPR033682  PFA4  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0019706  F:protein-cysteine S-palmitoyltransferase activity  
GO:0018345  P:protein palmitoylation  
Pfam View protein in Pfam  
PF01529  DHHC  
PROSITE View protein in PROSITE  
PS50216  DHHC  
Amino Acid Sequences MTTIKTGPSKLGMHLLAIPAAVLIITFLGYSSQWFFANAATYLEPGPLSTTECTVFNTLLCCLWWSYFRACTVDPGRYTFDEPGPSGDAVAQNAAAETATTATTTTASRPSSRPHASSVVSSRSSDSSSHAPTATSTVRWCKKCDAPKPRRAHHCRHCRRCIPKMDHHCPWTGNCVSMQTFPHFLRFVVFTNLSLWTLAVLLARRFYSLYDQRHLPAYLGPTLPQLVHMTVLGLVCGATTLALGLMLYTTVHAWVFNTTMIEGWEIDRHEAVVDRYSTTASDGGWWDEHDDNSSSSSSSEEDEDGYRRTKARRASAALRVRVEFPYDLGFFDNMAQAMGTRNVLWWFCPLASGPRVAPGGTGTGWDWPENGFNNRTGMWPPPDPEKLRHAAARSEWARHERRETTRAMVYASGRDGEQPPGATVEDEKAAFQARQAADFRRRRQQQMADEAEAAAATAAIADDDVDNSSDAFEEGMDGERGWMNADGDRLRDYGVDEDAEDDDNVPLAQLLQRRTTTGAKAAKGQKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.22
4 0.2
5 0.17
6 0.1
7 0.09
8 0.07
9 0.04
10 0.03
11 0.03
12 0.03
13 0.03
14 0.04
15 0.05
16 0.05
17 0.08
18 0.1
19 0.12
20 0.12
21 0.13
22 0.14
23 0.14
24 0.17
25 0.16
26 0.16
27 0.15
28 0.16
29 0.15
30 0.16
31 0.14
32 0.11
33 0.13
34 0.11
35 0.13
36 0.13
37 0.15
38 0.16
39 0.16
40 0.19
41 0.18
42 0.18
43 0.16
44 0.17
45 0.15
46 0.15
47 0.14
48 0.13
49 0.13
50 0.14
51 0.15
52 0.18
53 0.21
54 0.23
55 0.25
56 0.27
57 0.27
58 0.33
59 0.35
60 0.37
61 0.35
62 0.35
63 0.38
64 0.36
65 0.39
66 0.34
67 0.33
68 0.3
69 0.29
70 0.29
71 0.27
72 0.25
73 0.22
74 0.2
75 0.18
76 0.16
77 0.15
78 0.12
79 0.09
80 0.09
81 0.09
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.08
92 0.1
93 0.14
94 0.17
95 0.2
96 0.23
97 0.28
98 0.36
99 0.41
100 0.41
101 0.4
102 0.43
103 0.4
104 0.43
105 0.43
106 0.39
107 0.36
108 0.34
109 0.32
110 0.28
111 0.28
112 0.24
113 0.22
114 0.22
115 0.23
116 0.25
117 0.23
118 0.21
119 0.2
120 0.24
121 0.22
122 0.18
123 0.19
124 0.26
125 0.34
126 0.36
127 0.39
128 0.41
129 0.47
130 0.55
131 0.62
132 0.64
133 0.67
134 0.74
135 0.81
136 0.83
137 0.86
138 0.84
139 0.84
140 0.83
141 0.84
142 0.86
143 0.87
144 0.88
145 0.86
146 0.87
147 0.85
148 0.85
149 0.82
150 0.81
151 0.81
152 0.79
153 0.76
154 0.7
155 0.64
156 0.55
157 0.48
158 0.45
159 0.35
160 0.28
161 0.22
162 0.22
163 0.21
164 0.22
165 0.22
166 0.17
167 0.21
168 0.2
169 0.23
170 0.21
171 0.19
172 0.18
173 0.18
174 0.17
175 0.18
176 0.18
177 0.15
178 0.16
179 0.17
180 0.15
181 0.13
182 0.11
183 0.07
184 0.07
185 0.07
186 0.06
187 0.07
188 0.07
189 0.08
190 0.09
191 0.09
192 0.09
193 0.1
194 0.16
195 0.22
196 0.26
197 0.28
198 0.29
199 0.3
200 0.32
201 0.32
202 0.25
203 0.19
204 0.17
205 0.17
206 0.16
207 0.15
208 0.13
209 0.14
210 0.13
211 0.12
212 0.11
213 0.08
214 0.08
215 0.08
216 0.07
217 0.08
218 0.08
219 0.06
220 0.05
221 0.04
222 0.04
223 0.04
224 0.03
225 0.02
226 0.02
227 0.02
228 0.02
229 0.02
230 0.02
231 0.02
232 0.02
233 0.02
234 0.02
235 0.02
236 0.03
237 0.03
238 0.03
239 0.03
240 0.04
241 0.05
242 0.05
243 0.06
244 0.06
245 0.05
246 0.06
247 0.06
248 0.06
249 0.06
250 0.06
251 0.07
252 0.07
253 0.08
254 0.07
255 0.07
256 0.07
257 0.08
258 0.08
259 0.08
260 0.09
261 0.09
262 0.09
263 0.09
264 0.09
265 0.09
266 0.09
267 0.06
268 0.08
269 0.08
270 0.08
271 0.08
272 0.08
273 0.1
274 0.1
275 0.1
276 0.11
277 0.11
278 0.1
279 0.12
280 0.12
281 0.09
282 0.09
283 0.09
284 0.08
285 0.08
286 0.09
287 0.07
288 0.08
289 0.09
290 0.11
291 0.12
292 0.13
293 0.13
294 0.15
295 0.17
296 0.21
297 0.27
298 0.32
299 0.37
300 0.42
301 0.46
302 0.53
303 0.58
304 0.57
305 0.52
306 0.46
307 0.41
308 0.36
309 0.33
310 0.23
311 0.16
312 0.15
313 0.14
314 0.13
315 0.13
316 0.12
317 0.1
318 0.11
319 0.11
320 0.08
321 0.07
322 0.06
323 0.05
324 0.07
325 0.07
326 0.07
327 0.06
328 0.07
329 0.09
330 0.09
331 0.1
332 0.1
333 0.11
334 0.1
335 0.11
336 0.1
337 0.13
338 0.15
339 0.15
340 0.14
341 0.16
342 0.16
343 0.16
344 0.15
345 0.11
346 0.12
347 0.1
348 0.11
349 0.08
350 0.11
351 0.12
352 0.12
353 0.11
354 0.1
355 0.13
356 0.15
357 0.18
358 0.17
359 0.17
360 0.19
361 0.19
362 0.2
363 0.19
364 0.2
365 0.21
366 0.22
367 0.23
368 0.28
369 0.34
370 0.35
371 0.37
372 0.39
373 0.39
374 0.39
375 0.41
376 0.37
377 0.35
378 0.33
379 0.39
380 0.35
381 0.35
382 0.36
383 0.41
384 0.44
385 0.43
386 0.48
387 0.46
388 0.51
389 0.52
390 0.51
391 0.48
392 0.47
393 0.44
394 0.38
395 0.34
396 0.28
397 0.26
398 0.24
399 0.2
400 0.16
401 0.18
402 0.18
403 0.18
404 0.18
405 0.16
406 0.15
407 0.16
408 0.17
409 0.14
410 0.14
411 0.13
412 0.13
413 0.13
414 0.12
415 0.12
416 0.13
417 0.13
418 0.13
419 0.19
420 0.17
421 0.21
422 0.24
423 0.3
424 0.38
425 0.47
426 0.52
427 0.55
428 0.61
429 0.63
430 0.69
431 0.71
432 0.7
433 0.71
434 0.72
435 0.64
436 0.58
437 0.51
438 0.42
439 0.32
440 0.23
441 0.13
442 0.06
443 0.04
444 0.03
445 0.03
446 0.03
447 0.03
448 0.03
449 0.04
450 0.04
451 0.06
452 0.06
453 0.07
454 0.07
455 0.07
456 0.07
457 0.07
458 0.06
459 0.05
460 0.05
461 0.06
462 0.08
463 0.09
464 0.08
465 0.1
466 0.11
467 0.11
468 0.12
469 0.13
470 0.12
471 0.13
472 0.18
473 0.17
474 0.18
475 0.2
476 0.19
477 0.18
478 0.18
479 0.18
480 0.16
481 0.17
482 0.16
483 0.14
484 0.15
485 0.16
486 0.16
487 0.15
488 0.13
489 0.11
490 0.11
491 0.1
492 0.09
493 0.07
494 0.07
495 0.11
496 0.15
497 0.18
498 0.24
499 0.25
500 0.27
501 0.32
502 0.36
503 0.36
504 0.4
505 0.44
506 0.4
507 0.48
508 0.54