Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167QZ19

Protein Details
Accession A0A167QZ19    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-22RGTFRNPPPGRPRPRPDPADPBasic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012349  Split_barrel_FMN-bd  
Amino Acid Sequences MRGTFRNPPPGRPRPRPDPADPAVPGSGLGAPVDDDHLDDPAARANFRVVVLVPTEVDQVDLARADDPRRWFYRYVGDDGEEDAGNARDDEGDGEVINGWKKWEVWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.8
4 0.76
5 0.74
6 0.68
7 0.65
8 0.57
9 0.51
10 0.41
11 0.34
12 0.28
13 0.2
14 0.17
15 0.1
16 0.09
17 0.06
18 0.06
19 0.06
20 0.07
21 0.06
22 0.06
23 0.06
24 0.07
25 0.06
26 0.06
27 0.06
28 0.09
29 0.1
30 0.09
31 0.09
32 0.09
33 0.1
34 0.11
35 0.11
36 0.07
37 0.07
38 0.08
39 0.08
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.07
52 0.08
53 0.12
54 0.15
55 0.2
56 0.23
57 0.25
58 0.26
59 0.27
60 0.36
61 0.35
62 0.36
63 0.32
64 0.3
65 0.28
66 0.28
67 0.27
68 0.17
69 0.14
70 0.11
71 0.1
72 0.1
73 0.09
74 0.08
75 0.07
76 0.07
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.09
83 0.11
84 0.12
85 0.12
86 0.12
87 0.13