Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167TE70

Protein Details
Accession A0A167TE70   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
3-49SAKKHVPIVKKRTKHFIRHQSDRFKCVDSSWRKPKGIDSRVRRRFKGBasic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13.833, nucl 9, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKHFIRHQSDRFKCVDSSWRKPKGIDSRVRRRFKGNQVMPSIGFGSNKKTRHMMPSGHKAFLVSNVNDVEILLMHNRTYAAEIAHNVSSRKRIDIIARAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.8
4 0.81
5 0.81
6 0.8
7 0.83
8 0.86
9 0.86
10 0.82
11 0.76
12 0.68
13 0.6
14 0.51
15 0.43
16 0.44
17 0.42
18 0.47
19 0.53
20 0.58
21 0.56
22 0.56
23 0.62
24 0.63
25 0.64
26 0.63
27 0.63
28 0.67
29 0.76
30 0.8
31 0.73
32 0.7
33 0.69
34 0.7
35 0.71
36 0.66
37 0.63
38 0.6
39 0.6
40 0.53
41 0.45
42 0.37
43 0.26
44 0.21
45 0.14
46 0.17
47 0.22
48 0.23
49 0.23
50 0.24
51 0.25
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.39
60 0.35
61 0.31
62 0.29
63 0.27
64 0.17
65 0.17
66 0.16
67 0.17
68 0.16
69 0.15
70 0.1
71 0.06
72 0.07
73 0.05
74 0.06
75 0.05
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.11
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.22
90 0.22
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37