Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162JF61

Protein Details
Accession A0A162JF61   
Localization Confidence Low
Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
223-243AVEWLRSRVKWNKESRPPVKRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 9.5, mito 4, extr 4, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR024156  Small_GTPase_ARF  
IPR006689  Small_GTPase_ARF/SAR  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00025  Arf  
PROSITE View protein in PROSITE  
PS51417  ARF  
Amino Acid Sequences MPWTLARFALCAEYSVLLLGLDNAGKTTFHEQVKALYSPDQPAPKLQTVPTVGQNVSTITLSDMYMKIWDVGGQLSLRKLWQSYYQSCHAIVFIIDSTDIGDGSLDGTTTGGGGGGATNGLDGGVTTAAAAAAVAAAADDDDAGPGRLEECRLVLEDVLQHSDTEGVPLLILANKQDREDCVEVVRIKEGLVKKVFEGEKASSIRDSRVLPVSALTGTGVREAVEWLRSRVKWNKESRPPVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.08
5 0.08
6 0.07
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.07
13 0.1
14 0.14
15 0.2
16 0.21
17 0.23
18 0.24
19 0.27
20 0.32
21 0.31
22 0.27
23 0.25
24 0.26
25 0.27
26 0.32
27 0.32
28 0.28
29 0.31
30 0.35
31 0.34
32 0.35
33 0.32
34 0.33
35 0.33
36 0.35
37 0.34
38 0.32
39 0.29
40 0.27
41 0.27
42 0.21
43 0.19
44 0.16
45 0.12
46 0.09
47 0.1
48 0.09
49 0.1
50 0.1
51 0.09
52 0.09
53 0.1
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.08
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.1
67 0.1
68 0.17
69 0.23
70 0.27
71 0.31
72 0.34
73 0.35
74 0.35
75 0.33
76 0.25
77 0.19
78 0.14
79 0.1
80 0.07
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.03
90 0.04
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.01
122 0.01
123 0.01
124 0.01
125 0.02
126 0.02
127 0.02
128 0.02
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.05
135 0.05
136 0.06
137 0.06
138 0.07
139 0.08
140 0.08
141 0.08
142 0.08
143 0.09
144 0.1
145 0.12
146 0.11
147 0.1
148 0.1
149 0.11
150 0.1
151 0.09
152 0.08
153 0.06
154 0.05
155 0.06
156 0.06
157 0.06
158 0.06
159 0.07
160 0.12
161 0.13
162 0.14
163 0.15
164 0.16
165 0.22
166 0.24
167 0.22
168 0.19
169 0.24
170 0.25
171 0.24
172 0.25
173 0.18
174 0.16
175 0.21
176 0.22
177 0.24
178 0.25
179 0.25
180 0.24
181 0.32
182 0.32
183 0.29
184 0.3
185 0.26
186 0.3
187 0.3
188 0.31
189 0.27
190 0.28
191 0.28
192 0.27
193 0.26
194 0.23
195 0.27
196 0.27
197 0.24
198 0.23
199 0.23
200 0.19
201 0.18
202 0.14
203 0.1
204 0.1
205 0.11
206 0.1
207 0.08
208 0.09
209 0.1
210 0.12
211 0.16
212 0.17
213 0.2
214 0.27
215 0.28
216 0.36
217 0.43
218 0.5
219 0.55
220 0.64
221 0.7
222 0.74
223 0.84