Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162KY92

Protein Details
Accession A0A162KY92    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
268-289DRAWVVRCKKWCRKAGGGNGAEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, cyto_nucl 8, mito 7, nucl 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006680  Amidohydro-rel  
IPR032466  Metal_Hydrolase  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF04909  Amidohydro_2  
Amino Acid Sequences MGIVCSLFDRTDASLPAGAWDSHVHVVNEEKFPLHPLHPYRPKTADVADLLRFQASQGIAHNCLVAISVYHTDNRCLVGALRELKGQARGVACIDADAVTDDELRELHDAGVRAVRINLRSRLQQLSTEEFNTLLKKNADRIRPYGWALQIYVALHQVQQVADVMPSLDGVPVIIDHIAHPDAKKGLVQKQAGYEAFMRLLESGQVWTKLSGTYRFEDLPGLEDYVVEILRRAPDRVVWASDWPHTGGVPHNPGGDRNAVQDYRKIDDRAWVVRCKKWCRKAGGGNGAELVRKIWVDNPRKLWQYDDDGPKGNVPEKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.2
5 0.18
6 0.16
7 0.16
8 0.17
9 0.18
10 0.21
11 0.2
12 0.19
13 0.25
14 0.28
15 0.29
16 0.26
17 0.24
18 0.21
19 0.24
20 0.26
21 0.22
22 0.25
23 0.3
24 0.4
25 0.48
26 0.52
27 0.56
28 0.56
29 0.57
30 0.52
31 0.48
32 0.43
33 0.37
34 0.37
35 0.33
36 0.31
37 0.29
38 0.26
39 0.23
40 0.18
41 0.18
42 0.14
43 0.13
44 0.16
45 0.19
46 0.21
47 0.21
48 0.21
49 0.16
50 0.16
51 0.15
52 0.1
53 0.07
54 0.07
55 0.09
56 0.1
57 0.14
58 0.15
59 0.16
60 0.17
61 0.18
62 0.16
63 0.15
64 0.15
65 0.14
66 0.19
67 0.21
68 0.21
69 0.2
70 0.21
71 0.21
72 0.24
73 0.21
74 0.19
75 0.17
76 0.17
77 0.17
78 0.17
79 0.15
80 0.12
81 0.12
82 0.08
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.09
96 0.1
97 0.1
98 0.12
99 0.11
100 0.11
101 0.12
102 0.13
103 0.15
104 0.19
105 0.22
106 0.23
107 0.25
108 0.29
109 0.31
110 0.3
111 0.3
112 0.29
113 0.29
114 0.29
115 0.27
116 0.23
117 0.2
118 0.2
119 0.18
120 0.15
121 0.14
122 0.14
123 0.14
124 0.21
125 0.26
126 0.31
127 0.32
128 0.35
129 0.35
130 0.36
131 0.38
132 0.34
133 0.3
134 0.25
135 0.22
136 0.19
137 0.16
138 0.14
139 0.12
140 0.09
141 0.08
142 0.07
143 0.08
144 0.08
145 0.06
146 0.07
147 0.07
148 0.06
149 0.06
150 0.05
151 0.05
152 0.04
153 0.04
154 0.04
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.05
165 0.06
166 0.07
167 0.07
168 0.08
169 0.09
170 0.09
171 0.11
172 0.13
173 0.19
174 0.25
175 0.26
176 0.26
177 0.28
178 0.32
179 0.3
180 0.28
181 0.23
182 0.17
183 0.16
184 0.14
185 0.12
186 0.08
187 0.08
188 0.07
189 0.06
190 0.07
191 0.08
192 0.09
193 0.09
194 0.09
195 0.1
196 0.11
197 0.13
198 0.16
199 0.18
200 0.19
201 0.21
202 0.21
203 0.21
204 0.2
205 0.18
206 0.17
207 0.14
208 0.14
209 0.11
210 0.1
211 0.1
212 0.1
213 0.1
214 0.07
215 0.06
216 0.07
217 0.11
218 0.12
219 0.13
220 0.12
221 0.14
222 0.2
223 0.22
224 0.24
225 0.21
226 0.24
227 0.25
228 0.26
229 0.26
230 0.21
231 0.19
232 0.16
233 0.16
234 0.17
235 0.2
236 0.22
237 0.22
238 0.24
239 0.24
240 0.25
241 0.26
242 0.27
243 0.22
244 0.21
245 0.25
246 0.25
247 0.25
248 0.29
249 0.29
250 0.3
251 0.34
252 0.33
253 0.28
254 0.33
255 0.36
256 0.4
257 0.42
258 0.45
259 0.45
260 0.49
261 0.57
262 0.61
263 0.67
264 0.69
265 0.72
266 0.72
267 0.77
268 0.81
269 0.83
270 0.83
271 0.74
272 0.65
273 0.6
274 0.52
275 0.43
276 0.33
277 0.23
278 0.14
279 0.13
280 0.13
281 0.16
282 0.25
283 0.33
284 0.41
285 0.47
286 0.54
287 0.58
288 0.59
289 0.57
290 0.53
291 0.53
292 0.54
293 0.56
294 0.52
295 0.51
296 0.51
297 0.5
298 0.47