Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162KDY8

Protein Details
Accession A0A162KDY8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MARRKPRNRRPPPPPPPPSTLQHydrophilic
NLS Segment(s)
PositionSequence
3-15RRKPRNRRPPPPP
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MARRKPRNRRPPPPPPPPSTLQTLSVSSYAPSVPSSVPRDAYLHVDTLASWQQLVADLGIDGYYPSKTQCKKAIKTVHVNIRDFLDAIRNDEPVRRFPSRAALQRYTLANHRFYKKKKIVPGSPLAALLETLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.85
3 0.8
4 0.74
5 0.67
6 0.63
7 0.55
8 0.48
9 0.42
10 0.37
11 0.33
12 0.29
13 0.25
14 0.19
15 0.17
16 0.13
17 0.11
18 0.09
19 0.09
20 0.09
21 0.15
22 0.19
23 0.2
24 0.21
25 0.22
26 0.23
27 0.22
28 0.26
29 0.22
30 0.18
31 0.16
32 0.15
33 0.13
34 0.14
35 0.15
36 0.1
37 0.09
38 0.08
39 0.08
40 0.09
41 0.09
42 0.06
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.04
51 0.04
52 0.05
53 0.11
54 0.13
55 0.17
56 0.26
57 0.34
58 0.37
59 0.45
60 0.53
61 0.53
62 0.6
63 0.63
64 0.62
65 0.6
66 0.58
67 0.5
68 0.43
69 0.37
70 0.29
71 0.22
72 0.2
73 0.14
74 0.17
75 0.18
76 0.17
77 0.17
78 0.21
79 0.23
80 0.22
81 0.28
82 0.27
83 0.27
84 0.28
85 0.37
86 0.41
87 0.47
88 0.5
89 0.47
90 0.47
91 0.5
92 0.5
93 0.44
94 0.43
95 0.39
96 0.38
97 0.41
98 0.46
99 0.51
100 0.55
101 0.63
102 0.64
103 0.69
104 0.71
105 0.75
106 0.76
107 0.75
108 0.78
109 0.72
110 0.64
111 0.57
112 0.47
113 0.38