Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167XV39

Protein Details
Accession A0A167XV39    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
265-296ETEPLRVLVKKKRRTRRKRTVRSKHQFTVLRIHydrophilic
NLS Segment(s)
PositionSequence
274-287KKKRRTRRKRTVRS
Subcellular Location(s) mito 20, extr 3, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
Amino Acid Sequences MRPQPVVRAVRRAAARCGTTTPLPLFALPTTARVPHHPPPATPRCRSWPPASGTGGRCYSTPTAAATTTATARPPPDNTSTSSSTSPSTTPPSHSIPTLPASALAQALFASSGGAAAARPTTTADTTSTTSTTTGAGVNTAAAAASTNHPSVYATVLIYGRPYLVTPGDTLRLPFRMADVRPGDELRLDRVGVVGSRTVTAVGQKPQPQPQRQSQSGADSLLAPPASAPSLPPSTQIAAVDGNQAAAVVAHIPGASVRAVVLGLETEPLRVLVKKKRRTRRKRTVRSKHQFTVLRIQDVVLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.42
4 0.44
5 0.41
6 0.36
7 0.38
8 0.33
9 0.3
10 0.28
11 0.26
12 0.25
13 0.21
14 0.23
15 0.19
16 0.21
17 0.19
18 0.22
19 0.23
20 0.26
21 0.33
22 0.35
23 0.45
24 0.43
25 0.44
26 0.51
27 0.6
28 0.63
29 0.6
30 0.59
31 0.57
32 0.62
33 0.66
34 0.62
35 0.6
36 0.58
37 0.6
38 0.58
39 0.57
40 0.52
41 0.52
42 0.48
43 0.4
44 0.34
45 0.31
46 0.29
47 0.23
48 0.22
49 0.17
50 0.17
51 0.17
52 0.18
53 0.14
54 0.14
55 0.15
56 0.15
57 0.14
58 0.13
59 0.15
60 0.17
61 0.19
62 0.22
63 0.25
64 0.26
65 0.29
66 0.34
67 0.34
68 0.34
69 0.33
70 0.3
71 0.26
72 0.26
73 0.23
74 0.19
75 0.22
76 0.21
77 0.24
78 0.26
79 0.3
80 0.29
81 0.29
82 0.28
83 0.24
84 0.25
85 0.22
86 0.18
87 0.14
88 0.13
89 0.13
90 0.12
91 0.09
92 0.07
93 0.05
94 0.06
95 0.05
96 0.04
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.04
107 0.05
108 0.07
109 0.07
110 0.08
111 0.09
112 0.11
113 0.13
114 0.14
115 0.13
116 0.12
117 0.12
118 0.11
119 0.1
120 0.09
121 0.08
122 0.07
123 0.07
124 0.06
125 0.06
126 0.05
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.05
133 0.07
134 0.07
135 0.07
136 0.07
137 0.08
138 0.08
139 0.08
140 0.07
141 0.06
142 0.07
143 0.08
144 0.08
145 0.08
146 0.07
147 0.06
148 0.05
149 0.06
150 0.05
151 0.06
152 0.06
153 0.07
154 0.08
155 0.1
156 0.1
157 0.1
158 0.11
159 0.11
160 0.11
161 0.1
162 0.11
163 0.14
164 0.15
165 0.21
166 0.21
167 0.22
168 0.23
169 0.23
170 0.21
171 0.19
172 0.19
173 0.15
174 0.14
175 0.13
176 0.11
177 0.11
178 0.11
179 0.09
180 0.1
181 0.08
182 0.07
183 0.07
184 0.08
185 0.08
186 0.07
187 0.1
188 0.13
189 0.15
190 0.2
191 0.26
192 0.3
193 0.38
194 0.47
195 0.5
196 0.53
197 0.59
198 0.63
199 0.59
200 0.6
201 0.54
202 0.5
203 0.45
204 0.39
205 0.3
206 0.22
207 0.2
208 0.17
209 0.15
210 0.1
211 0.08
212 0.08
213 0.09
214 0.08
215 0.08
216 0.1
217 0.14
218 0.15
219 0.17
220 0.19
221 0.19
222 0.21
223 0.2
224 0.18
225 0.15
226 0.15
227 0.16
228 0.13
229 0.12
230 0.1
231 0.1
232 0.08
233 0.06
234 0.06
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.05
241 0.06
242 0.06
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.05
250 0.05
251 0.07
252 0.07
253 0.07
254 0.07
255 0.08
256 0.1
257 0.13
258 0.19
259 0.28
260 0.38
261 0.48
262 0.58
263 0.69
264 0.78
265 0.87
266 0.91
267 0.93
268 0.94
269 0.95
270 0.97
271 0.97
272 0.97
273 0.97
274 0.95
275 0.9
276 0.88
277 0.84
278 0.78
279 0.78
280 0.72
281 0.64
282 0.55