Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167Y6U9

Protein Details
Accession A0A167Y6U9   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-106MLLTAQPDKRRRARPRSCGSTRLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 2, cyto 1, extr 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13923  zf-C3HC4_2  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MDLEKELTCSICTELLYQPLTLLDCLHTFCGACLKEWFAWQARAAETRPTPPAPGTPVFTCPACRDAVRSTKHNATVATLLDMLLTAQPDKRRRARPRSCGSTRLNANCWTTCAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.2
4 0.18
5 0.17
6 0.16
7 0.17
8 0.14
9 0.13
10 0.1
11 0.1
12 0.11
13 0.11
14 0.11
15 0.1
16 0.1
17 0.16
18 0.14
19 0.15
20 0.15
21 0.17
22 0.18
23 0.19
24 0.21
25 0.17
26 0.19
27 0.19
28 0.2
29 0.18
30 0.2
31 0.2
32 0.22
33 0.2
34 0.21
35 0.23
36 0.21
37 0.21
38 0.19
39 0.19
40 0.18
41 0.19
42 0.19
43 0.17
44 0.18
45 0.19
46 0.18
47 0.18
48 0.15
49 0.16
50 0.14
51 0.13
52 0.14
53 0.18
54 0.25
55 0.27
56 0.29
57 0.32
58 0.35
59 0.38
60 0.37
61 0.33
62 0.27
63 0.26
64 0.23
65 0.19
66 0.15
67 0.12
68 0.1
69 0.1
70 0.08
71 0.06
72 0.06
73 0.06
74 0.09
75 0.16
76 0.22
77 0.3
78 0.39
79 0.49
80 0.59
81 0.69
82 0.77
83 0.81
84 0.86
85 0.88
86 0.85
87 0.83
88 0.78
89 0.77
90 0.75
91 0.7
92 0.64
93 0.6
94 0.58
95 0.51