Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5JYF2

Protein Details
Accession J5JYF2   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-76SRAASPAPKKEKKSKKHDPLRSAVKMNHydrophilic
NLS Segment(s)
PositionSequence
54-67SPAPKKEKKSKKHD
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MYSAELVYITPYLMSAEKRREVSRINSAASSRKNSLVAAGESTATSAVPSRAASPAPKKEKKSKKHDPLRSAVKMNINSRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.23
4 0.28
5 0.32
6 0.33
7 0.35
8 0.38
9 0.4
10 0.44
11 0.41
12 0.38
13 0.36
14 0.37
15 0.39
16 0.38
17 0.36
18 0.28
19 0.27
20 0.26
21 0.24
22 0.24
23 0.2
24 0.17
25 0.14
26 0.12
27 0.11
28 0.1
29 0.1
30 0.08
31 0.05
32 0.05
33 0.04
34 0.05
35 0.05
36 0.06
37 0.07
38 0.08
39 0.1
40 0.14
41 0.21
42 0.31
43 0.4
44 0.46
45 0.52
46 0.61
47 0.7
48 0.76
49 0.79
50 0.81
51 0.82
52 0.86
53 0.9
54 0.87
55 0.86
56 0.86
57 0.82
58 0.75
59 0.69
60 0.66
61 0.64
62 0.6