Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167N9F5

Protein Details
Accession A0A167N9F5   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MKGKQKSRFGCRNCKLRKVKCDELKPQCGKCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MKGKQKSRFGCRNCKLRKVKCDELKPQCGKCRNYGVICNYGFNVPDLKPVSEERVKQDVAKCSRRPLLRAGIAGSAVWIGEGPTYYTLDMYDLGLFHRLRHRTLDSLGGRAMMDIYEKHIFNKSFTVSLAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.83
4 0.85
5 0.83
6 0.85
7 0.84
8 0.85
9 0.85
10 0.84
11 0.85
12 0.82
13 0.79
14 0.77
15 0.76
16 0.69
17 0.65
18 0.65
19 0.61
20 0.57
21 0.57
22 0.52
23 0.51
24 0.48
25 0.43
26 0.34
27 0.29
28 0.25
29 0.19
30 0.18
31 0.11
32 0.16
33 0.17
34 0.17
35 0.18
36 0.18
37 0.24
38 0.25
39 0.27
40 0.26
41 0.29
42 0.29
43 0.3
44 0.33
45 0.35
46 0.38
47 0.44
48 0.4
49 0.4
50 0.45
51 0.44
52 0.41
53 0.38
54 0.37
55 0.32
56 0.32
57 0.29
58 0.23
59 0.22
60 0.2
61 0.15
62 0.08
63 0.06
64 0.05
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.07
81 0.12
82 0.12
83 0.13
84 0.2
85 0.22
86 0.23
87 0.28
88 0.31
89 0.3
90 0.32
91 0.39
92 0.33
93 0.33
94 0.32
95 0.27
96 0.24
97 0.2
98 0.19
99 0.1
100 0.1
101 0.08
102 0.13
103 0.16
104 0.17
105 0.19
106 0.25
107 0.26
108 0.27
109 0.32
110 0.3
111 0.27