Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167VAP3

Protein Details
Accession A0A167VAP3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
53-75VPLHLPGRTRKRLRNNRPSDAEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MSRLIKRKRSDSELSFSSSTTLSSPPRPGGFDFAAMTDRKNHLVAPTAGAAAVPLHLPGRTRKRLRNNRPSDAEVHGMSYRVLSLCMLLAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.5
3 0.42
4 0.36
5 0.27
6 0.22
7 0.16
8 0.17
9 0.15
10 0.18
11 0.21
12 0.23
13 0.24
14 0.26
15 0.25
16 0.27
17 0.25
18 0.23
19 0.2
20 0.18
21 0.19
22 0.17
23 0.16
24 0.15
25 0.15
26 0.15
27 0.15
28 0.14
29 0.13
30 0.16
31 0.16
32 0.14
33 0.13
34 0.12
35 0.11
36 0.11
37 0.1
38 0.06
39 0.06
40 0.04
41 0.04
42 0.04
43 0.05
44 0.07
45 0.14
46 0.23
47 0.32
48 0.39
49 0.47
50 0.58
51 0.69
52 0.79
53 0.83
54 0.83
55 0.83
56 0.82
57 0.77
58 0.69
59 0.62
60 0.55
61 0.44
62 0.38
63 0.3
64 0.24
65 0.21
66 0.17
67 0.15
68 0.11
69 0.11
70 0.08
71 0.08