Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167MZT6

Protein Details
Accession A0A167MZT6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
133-161GTQARRGRDEDRNSRRNRRKPDSARLTLYHydrophilic
NLS Segment(s)
PositionSequence
137-152RRGRDEDRNSRRNRRK
Subcellular Location(s) extr 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR014756  Ig_E-set  
IPR005066  MoCF_OxRdtse_dimer  
IPR008335  Mopterin_OxRdtase_euk  
IPR000572  OxRdtase_Mopterin-bd_dom  
IPR036374  OxRdtase_Mopterin-bd_sf  
Gene Ontology GO:0030151  F:molybdenum ion binding  
GO:0050464  F:nitrate reductase (NADPH) activity  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PF03404  Mo-co_dimer  
PF00174  Oxidored_molyb  
PROSITE View protein in PROSITE  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MRTFVAMRTVVEWCRLSANCSRRPIPAVFATRCGAAAAFSSWASPLSQKPTTSRSQNVRAQVPTCKCDAFVQPTPSRTVRAFSAGRVYRYPFESAKGTSKTQDGPEERGAETGTRALARARARARAQHDQAGGTQARRGRDEDRNSRRNRRKPDSARLTLYAGVGLLSVLLVVSQPLRLSSVYAGVSEPDRGTDPKPDPEHNGIRTGDDTSGLAAATTTTTADGDGRDPSLPRYRLADIRRHDARSGAPWVTSGDKVYDITDWVPAHPGGDVILRAAGHSIDPYWAIFTIHQAPHVREILDSYLIGLVDAADLVDAHGAGAAVDDPFAQDPVRDPRLLVHTAKPCNAETPCTDLARDFLTPNPLFYVRNHMWVPVDDADADANDNANDNDNERKGQADKAYRLTVELPDGAVRAYTLDELRRRFPVHRVTAVLQCSGNRRSDMARAVAPTNGLPWRAGAIGNAVWEGAAWAIDRRGPSRRAPAGVRDPQAWQAAHFPRNKNDNNDNNDNNNKNNTALPVAVTGYAYSGGGRSIIRVDVSVDGGRTWDQAELLDRKTAPGDSPEERTGRHMVARGRRDWAWTRWRYAGVLYNLDRDPIHNNNNQEHDGGASTGCAEIIVKATDSACNTQPERHDSIFNVRGNLANAWHRVRVCPAAAHGGGAKPTNTGSADAVCVQGCGFDETDKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.29
4 0.33
5 0.41
6 0.44
7 0.5
8 0.52
9 0.5
10 0.55
11 0.53
12 0.51
13 0.51
14 0.52
15 0.47
16 0.48
17 0.45
18 0.41
19 0.38
20 0.32
21 0.23
22 0.15
23 0.14
24 0.11
25 0.11
26 0.11
27 0.11
28 0.11
29 0.12
30 0.12
31 0.14
32 0.17
33 0.23
34 0.27
35 0.29
36 0.34
37 0.39
38 0.46
39 0.5
40 0.54
41 0.55
42 0.6
43 0.64
44 0.66
45 0.67
46 0.64
47 0.6
48 0.6
49 0.58
50 0.51
51 0.48
52 0.41
53 0.36
54 0.35
55 0.39
56 0.38
57 0.4
58 0.46
59 0.48
60 0.49
61 0.54
62 0.51
63 0.48
64 0.4
65 0.36
66 0.29
67 0.32
68 0.31
69 0.28
70 0.36
71 0.37
72 0.39
73 0.39
74 0.4
75 0.37
76 0.38
77 0.41
78 0.32
79 0.31
80 0.32
81 0.33
82 0.36
83 0.37
84 0.36
85 0.34
86 0.36
87 0.37
88 0.37
89 0.42
90 0.38
91 0.4
92 0.43
93 0.43
94 0.4
95 0.36
96 0.33
97 0.25
98 0.23
99 0.18
100 0.15
101 0.12
102 0.12
103 0.13
104 0.18
105 0.2
106 0.27
107 0.29
108 0.35
109 0.38
110 0.45
111 0.51
112 0.55
113 0.57
114 0.55
115 0.53
116 0.47
117 0.44
118 0.44
119 0.38
120 0.28
121 0.28
122 0.24
123 0.25
124 0.26
125 0.28
126 0.28
127 0.36
128 0.45
129 0.53
130 0.6
131 0.67
132 0.73
133 0.81
134 0.85
135 0.85
136 0.86
137 0.84
138 0.85
139 0.85
140 0.88
141 0.87
142 0.83
143 0.79
144 0.7
145 0.64
146 0.54
147 0.44
148 0.33
149 0.23
150 0.16
151 0.11
152 0.08
153 0.05
154 0.03
155 0.03
156 0.02
157 0.02
158 0.02
159 0.03
160 0.03
161 0.04
162 0.05
163 0.05
164 0.07
165 0.07
166 0.08
167 0.09
168 0.12
169 0.12
170 0.12
171 0.12
172 0.12
173 0.12
174 0.13
175 0.12
176 0.09
177 0.11
178 0.12
179 0.14
180 0.21
181 0.24
182 0.3
183 0.34
184 0.36
185 0.4
186 0.45
187 0.51
188 0.45
189 0.46
190 0.39
191 0.36
192 0.34
193 0.3
194 0.23
195 0.16
196 0.15
197 0.1
198 0.1
199 0.08
200 0.07
201 0.05
202 0.05
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.05
209 0.05
210 0.06
211 0.07
212 0.08
213 0.09
214 0.09
215 0.1
216 0.14
217 0.21
218 0.22
219 0.22
220 0.25
221 0.27
222 0.33
223 0.37
224 0.41
225 0.36
226 0.43
227 0.47
228 0.46
229 0.43
230 0.38
231 0.35
232 0.31
233 0.32
234 0.25
235 0.2
236 0.18
237 0.2
238 0.2
239 0.18
240 0.15
241 0.11
242 0.11
243 0.11
244 0.12
245 0.1
246 0.09
247 0.09
248 0.12
249 0.12
250 0.11
251 0.12
252 0.12
253 0.11
254 0.1
255 0.1
256 0.07
257 0.07
258 0.07
259 0.05
260 0.06
261 0.06
262 0.06
263 0.06
264 0.06
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.05
271 0.06
272 0.06
273 0.06
274 0.06
275 0.08
276 0.14
277 0.14
278 0.18
279 0.19
280 0.2
281 0.23
282 0.24
283 0.22
284 0.15
285 0.16
286 0.14
287 0.13
288 0.12
289 0.08
290 0.08
291 0.07
292 0.07
293 0.06
294 0.04
295 0.03
296 0.03
297 0.03
298 0.02
299 0.02
300 0.02
301 0.02
302 0.02
303 0.02
304 0.02
305 0.02
306 0.02
307 0.03
308 0.03
309 0.03
310 0.03
311 0.03
312 0.03
313 0.03
314 0.04
315 0.04
316 0.04
317 0.07
318 0.12
319 0.15
320 0.15
321 0.15
322 0.17
323 0.21
324 0.24
325 0.23
326 0.23
327 0.27
328 0.29
329 0.31
330 0.31
331 0.27
332 0.28
333 0.26
334 0.23
335 0.17
336 0.22
337 0.22
338 0.2
339 0.2
340 0.16
341 0.17
342 0.16
343 0.16
344 0.1
345 0.09
346 0.16
347 0.16
348 0.16
349 0.17
350 0.16
351 0.16
352 0.16
353 0.24
354 0.18
355 0.23
356 0.23
357 0.22
358 0.21
359 0.21
360 0.24
361 0.16
362 0.15
363 0.1
364 0.11
365 0.1
366 0.09
367 0.09
368 0.05
369 0.04
370 0.04
371 0.05
372 0.05
373 0.06
374 0.07
375 0.08
376 0.11
377 0.12
378 0.12
379 0.12
380 0.14
381 0.13
382 0.16
383 0.2
384 0.23
385 0.26
386 0.29
387 0.3
388 0.29
389 0.28
390 0.27
391 0.22
392 0.17
393 0.14
394 0.1
395 0.09
396 0.09
397 0.08
398 0.07
399 0.06
400 0.05
401 0.05
402 0.06
403 0.07
404 0.11
405 0.15
406 0.18
407 0.2
408 0.23
409 0.25
410 0.26
411 0.32
412 0.37
413 0.38
414 0.38
415 0.39
416 0.39
417 0.41
418 0.41
419 0.35
420 0.27
421 0.23
422 0.25
423 0.24
424 0.23
425 0.19
426 0.19
427 0.2
428 0.23
429 0.25
430 0.23
431 0.22
432 0.22
433 0.22
434 0.21
435 0.2
436 0.15
437 0.15
438 0.14
439 0.13
440 0.11
441 0.1
442 0.11
443 0.11
444 0.11
445 0.08
446 0.09
447 0.09
448 0.09
449 0.09
450 0.08
451 0.07
452 0.06
453 0.06
454 0.04
455 0.04
456 0.03
457 0.04
458 0.05
459 0.07
460 0.08
461 0.11
462 0.17
463 0.2
464 0.24
465 0.33
466 0.36
467 0.39
468 0.4
469 0.45
470 0.49
471 0.53
472 0.51
473 0.43
474 0.41
475 0.4
476 0.42
477 0.34
478 0.26
479 0.27
480 0.31
481 0.36
482 0.4
483 0.4
484 0.43
485 0.51
486 0.55
487 0.54
488 0.58
489 0.6
490 0.62
491 0.66
492 0.64
493 0.61
494 0.64
495 0.59
496 0.53
497 0.48
498 0.41
499 0.34
500 0.31
501 0.27
502 0.21
503 0.19
504 0.16
505 0.14
506 0.14
507 0.13
508 0.11
509 0.09
510 0.08
511 0.08
512 0.07
513 0.06
514 0.06
515 0.05
516 0.07
517 0.07
518 0.07
519 0.08
520 0.09
521 0.09
522 0.09
523 0.11
524 0.1
525 0.13
526 0.13
527 0.12
528 0.11
529 0.12
530 0.12
531 0.11
532 0.11
533 0.09
534 0.08
535 0.09
536 0.15
537 0.17
538 0.19
539 0.22
540 0.21
541 0.21
542 0.23
543 0.22
544 0.18
545 0.19
546 0.23
547 0.22
548 0.28
549 0.31
550 0.31
551 0.31
552 0.34
553 0.33
554 0.3
555 0.3
556 0.29
557 0.32
558 0.4
559 0.46
560 0.44
561 0.46
562 0.45
563 0.48
564 0.49
565 0.51
566 0.52
567 0.5
568 0.53
569 0.52
570 0.53
571 0.47
572 0.44
573 0.44
574 0.37
575 0.4
576 0.36
577 0.37
578 0.35
579 0.36
580 0.32
581 0.26
582 0.28
583 0.28
584 0.33
585 0.33
586 0.38
587 0.42
588 0.47
589 0.47
590 0.41
591 0.34
592 0.28
593 0.24
594 0.2
595 0.15
596 0.1
597 0.09
598 0.08
599 0.08
600 0.06
601 0.05
602 0.06
603 0.08
604 0.09
605 0.09
606 0.1
607 0.11
608 0.14
609 0.17
610 0.2
611 0.21
612 0.26
613 0.28
614 0.32
615 0.36
616 0.4
617 0.44
618 0.43
619 0.42
620 0.39
621 0.47
622 0.5
623 0.47
624 0.42
625 0.36
626 0.36
627 0.36
628 0.34
629 0.29
630 0.27
631 0.3
632 0.31
633 0.35
634 0.34
635 0.34
636 0.37
637 0.38
638 0.34
639 0.32
640 0.31
641 0.34
642 0.33
643 0.32
644 0.29
645 0.26
646 0.26
647 0.26
648 0.23
649 0.17
650 0.17
651 0.19
652 0.19
653 0.18
654 0.18
655 0.17
656 0.19
657 0.19
658 0.2
659 0.16
660 0.15
661 0.13
662 0.13
663 0.12
664 0.13
665 0.13
666 0.15