Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162MCS5

Protein Details
Accession A0A162MCS5   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-46LRLKGAKVAKPGKKHKHKKTRGERKDKSREGASBasic
NLS Segment(s)
PositionSequence
15-44RLKGAKVAKPGKKHKHKKTRGERKDKSREG
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSGDYAAAAGGALRLKGAKVAKPGKKHKHKKTRGERKDKSREGASDDRSPRAKTATTENNNARSEAAHNETKEQDEPVDPYARMTAAERRFAEAQDKKIRDLLHAGPEEVRAARPELFKSHKERLADLNTYLSRMSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.13
5 0.16
6 0.18
7 0.27
8 0.37
9 0.43
10 0.53
11 0.64
12 0.7
13 0.78
14 0.85
15 0.86
16 0.88
17 0.92
18 0.93
19 0.94
20 0.94
21 0.94
22 0.95
23 0.93
24 0.92
25 0.93
26 0.87
27 0.81
28 0.75
29 0.66
30 0.62
31 0.61
32 0.54
33 0.52
34 0.49
35 0.48
36 0.45
37 0.44
38 0.37
39 0.32
40 0.29
41 0.22
42 0.28
43 0.34
44 0.35
45 0.41
46 0.44
47 0.47
48 0.46
49 0.45
50 0.37
51 0.27
52 0.25
53 0.2
54 0.21
55 0.18
56 0.17
57 0.19
58 0.2
59 0.21
60 0.19
61 0.16
62 0.13
63 0.11
64 0.12
65 0.12
66 0.14
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.11
73 0.16
74 0.17
75 0.23
76 0.23
77 0.25
78 0.26
79 0.26
80 0.34
81 0.3
82 0.35
83 0.39
84 0.4
85 0.37
86 0.4
87 0.4
88 0.33
89 0.34
90 0.29
91 0.28
92 0.28
93 0.27
94 0.24
95 0.25
96 0.24
97 0.2
98 0.17
99 0.11
100 0.12
101 0.15
102 0.17
103 0.19
104 0.24
105 0.29
106 0.34
107 0.4
108 0.46
109 0.47
110 0.47
111 0.47
112 0.48
113 0.49
114 0.47
115 0.41
116 0.4
117 0.36
118 0.35
119 0.32
120 0.25
121 0.19
122 0.17
123 0.21
124 0.2
125 0.23
126 0.29
127 0.34
128 0.36