Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162J2D7

Protein Details
Accession A0A162J2D7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-33DAPRNLVKGRLKPPKRNPAPPSHydrophilic
NLS Segment(s)
PositionSequence
20-27GRLKPPKR
Subcellular Location(s) nucl 12, cyto_nucl 10.5, cyto 7, mito 6
Family & Domain DBs
Amino Acid Sequences MPAEDKGGAGNDAPRNLVKGRLKPPKRNPAPPSYTQAPVFKNEMTLERPGSDSRPPAVEFCSTALPQPFVNPNAPLGRRAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.29
5 0.29
6 0.34
7 0.43
8 0.52
9 0.6
10 0.68
11 0.77
12 0.8
13 0.82
14 0.84
15 0.79
16 0.78
17 0.76
18 0.69
19 0.66
20 0.58
21 0.53
22 0.46
23 0.44
24 0.36
25 0.31
26 0.3
27 0.23
28 0.2
29 0.18
30 0.18
31 0.16
32 0.17
33 0.15
34 0.14
35 0.16
36 0.15
37 0.17
38 0.18
39 0.17
40 0.17
41 0.19
42 0.19
43 0.19
44 0.2
45 0.19
46 0.17
47 0.17
48 0.2
49 0.17
50 0.19
51 0.2
52 0.19
53 0.18
54 0.21
55 0.24
56 0.23
57 0.25
58 0.23
59 0.26
60 0.32
61 0.33