Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167TVC6

Protein Details
Accession A0A167TVC6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-101VYKPPTGFRKDCKKCRCRKHDSHNIFETPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, cyto_mito 5.166, mito 4.5, cyto 4.5, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences MHLQSVLLLGTAFLGSLAGVTSLAVPSLVSMNVDLGSAEEVNAPPKYIVHCSGDPYPPSKCFAPWGKYRHDGVYKPPTGFRKDCKKCRCRKHDSHNIFETPDLQTPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.04
5 0.03
6 0.03
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.06
21 0.05
22 0.05
23 0.06
24 0.05
25 0.05
26 0.06
27 0.06
28 0.08
29 0.08
30 0.09
31 0.07
32 0.08
33 0.1
34 0.12
35 0.14
36 0.16
37 0.16
38 0.19
39 0.22
40 0.24
41 0.23
42 0.22
43 0.22
44 0.19
45 0.21
46 0.19
47 0.16
48 0.19
49 0.25
50 0.28
51 0.34
52 0.37
53 0.39
54 0.44
55 0.45
56 0.45
57 0.44
58 0.4
59 0.41
60 0.47
61 0.45
62 0.41
63 0.45
64 0.44
65 0.45
66 0.48
67 0.48
68 0.49
69 0.57
70 0.66
71 0.71
72 0.77
73 0.81
74 0.88
75 0.9
76 0.89
77 0.9
78 0.91
79 0.91
80 0.89
81 0.88
82 0.84
83 0.76
84 0.66
85 0.56
86 0.48
87 0.4
88 0.37