Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162J5Y7

Protein Details
Accession A0A162J5Y7   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-88DESSRKQRRGRKTSTSHSKSSHydrophilic
NLS Segment(s)
PositionSequence
75-78RRGR
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MYECYRDHNGYTCLVLVNGREYQTDLAYKSDLLAQENAAMRAFMVCRNFSVNGGMLARNGIVQGLPVDESSRKQRRGRKTSTSHSKSSHSSRRSGTHSSSSSTASFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.13
4 0.14
5 0.15
6 0.15
7 0.14
8 0.15
9 0.16
10 0.17
11 0.18
12 0.15
13 0.15
14 0.14
15 0.14
16 0.13
17 0.14
18 0.13
19 0.13
20 0.13
21 0.11
22 0.14
23 0.16
24 0.16
25 0.13
26 0.12
27 0.1
28 0.1
29 0.1
30 0.09
31 0.1
32 0.1
33 0.1
34 0.13
35 0.13
36 0.13
37 0.14
38 0.12
39 0.11
40 0.11
41 0.11
42 0.08
43 0.08
44 0.07
45 0.06
46 0.06
47 0.04
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.06
55 0.07
56 0.1
57 0.19
58 0.27
59 0.33
60 0.4
61 0.48
62 0.58
63 0.67
64 0.73
65 0.73
66 0.74
67 0.79
68 0.83
69 0.81
70 0.76
71 0.69
72 0.66
73 0.62
74 0.63
75 0.62
76 0.54
77 0.55
78 0.54
79 0.57
80 0.58
81 0.58
82 0.53
83 0.52
84 0.51
85 0.49
86 0.46
87 0.42