Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167M1P8

Protein Details
Accession A0A167M1P8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-75DEMERFRQCWKQQKNDERTSMKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.333, cyto 4.5, cyto_pero 4.166, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039870  Coa4-like  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSKDESNAAETAKQIEEDEPDEWEQRIFSTGCADENAKLTDCYYEKKDWRACKDEMERFRQCWKQQKNDERTSMKDAEPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.17
5 0.16
6 0.16
7 0.17
8 0.17
9 0.17
10 0.16
11 0.13
12 0.11
13 0.13
14 0.11
15 0.09
16 0.11
17 0.11
18 0.12
19 0.13
20 0.14
21 0.12
22 0.13
23 0.14
24 0.12
25 0.11
26 0.11
27 0.12
28 0.12
29 0.14
30 0.16
31 0.2
32 0.22
33 0.29
34 0.36
35 0.4
36 0.46
37 0.49
38 0.46
39 0.5
40 0.56
41 0.57
42 0.57
43 0.58
44 0.56
45 0.53
46 0.59
47 0.58
48 0.56
49 0.58
50 0.61
51 0.63
52 0.7
53 0.78
54 0.8
55 0.81
56 0.83
57 0.78
58 0.75
59 0.71
60 0.64
61 0.55