Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162J3G6

Protein Details
Accession A0A162J3G6   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-106RDSKASFPRKSKRRHQKSHWRKPKGGHRPPRRADSABasic
NLS Segment(s)
PositionSequence
67-107GRGTRDSKASFPRKSKRRHQKSHWRKPKGGHRPPRRADSAR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MDPLIESFRKETFFLELTEPIRKSLSASIDTKSASLREVATKAENFYLQSEGRTQSKRFPQSRPDEGRGTRDSKASFPRKSKRRHQKSHWRKPKGGHRPPRRADSARPTGRPLSEVTYYKCYRKGYYSNDYRSNPKVQSTSAEARESTLSSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.25
5 0.32
6 0.31
7 0.27
8 0.26
9 0.24
10 0.23
11 0.24
12 0.26
13 0.25
14 0.26
15 0.26
16 0.27
17 0.28
18 0.26
19 0.22
20 0.18
21 0.13
22 0.13
23 0.13
24 0.14
25 0.15
26 0.16
27 0.19
28 0.19
29 0.2
30 0.2
31 0.19
32 0.16
33 0.16
34 0.18
35 0.14
36 0.14
37 0.15
38 0.17
39 0.21
40 0.23
41 0.23
42 0.27
43 0.36
44 0.44
45 0.46
46 0.48
47 0.52
48 0.57
49 0.65
50 0.65
51 0.61
52 0.57
53 0.54
54 0.55
55 0.49
56 0.45
57 0.36
58 0.32
59 0.29
60 0.27
61 0.35
62 0.37
63 0.38
64 0.43
65 0.51
66 0.56
67 0.63
68 0.71
69 0.73
70 0.76
71 0.81
72 0.83
73 0.86
74 0.89
75 0.93
76 0.93
77 0.89
78 0.83
79 0.81
80 0.82
81 0.82
82 0.8
83 0.8
84 0.79
85 0.82
86 0.83
87 0.81
88 0.78
89 0.7
90 0.67
91 0.66
92 0.66
93 0.62
94 0.59
95 0.56
96 0.52
97 0.48
98 0.42
99 0.35
100 0.29
101 0.28
102 0.29
103 0.29
104 0.34
105 0.36
106 0.37
107 0.41
108 0.39
109 0.37
110 0.41
111 0.45
112 0.45
113 0.53
114 0.6
115 0.62
116 0.67
117 0.68
118 0.66
119 0.63
120 0.62
121 0.54
122 0.5
123 0.45
124 0.38
125 0.4
126 0.42
127 0.45
128 0.42
129 0.42
130 0.37
131 0.36
132 0.36
133 0.33