Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167MNM7

Protein Details
Accession A0A167MNM7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
42-72TTEVTVTRRSRRRSRRRGGCRERCRQRRLDTBasic
NLS Segment(s)
PositionSequence
49-59RRSRRRSRRRG
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MVVENSQENDYESVLSAAARPPHLSSAASLLKSLVVPPLATTTEVTVTRRSRRRSRRRGGCRERCRQRRLDTVPDEYLSGLHHGIDVDLNVTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.11
5 0.13
6 0.13
7 0.14
8 0.15
9 0.16
10 0.18
11 0.17
12 0.15
13 0.19
14 0.21
15 0.2
16 0.19
17 0.17
18 0.16
19 0.15
20 0.15
21 0.1
22 0.07
23 0.06
24 0.07
25 0.09
26 0.09
27 0.09
28 0.09
29 0.08
30 0.11
31 0.12
32 0.12
33 0.16
34 0.19
35 0.26
36 0.32
37 0.38
38 0.46
39 0.56
40 0.67
41 0.72
42 0.8
43 0.84
44 0.88
45 0.93
46 0.94
47 0.94
48 0.92
49 0.92
50 0.92
51 0.91
52 0.87
53 0.84
54 0.79
55 0.79
56 0.76
57 0.75
58 0.7
59 0.66
60 0.62
61 0.55
62 0.48
63 0.38
64 0.31
65 0.22
66 0.18
67 0.12
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09