Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167T8W0

Protein Details
Accession A0A167T8W0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-54AARSSQRKREENRRKKEKREAEEABasic
NLS Segment(s)
PositionSequence
36-49QRKREENRRKKEKR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MSTPIDPDARKEVNDAIANAGSAAIGQLVDAARSSQRKREENRRKKEKREAEEAAEAAAVTAGRENNSQDTKDTST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.24
4 0.22
5 0.21
6 0.18
7 0.16
8 0.09
9 0.07
10 0.06
11 0.03
12 0.03
13 0.02
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.08
20 0.12
21 0.14
22 0.19
23 0.26
24 0.32
25 0.38
26 0.49
27 0.58
28 0.64
29 0.74
30 0.79
31 0.81
32 0.83
33 0.88
34 0.86
35 0.81
36 0.79
37 0.73
38 0.67
39 0.62
40 0.53
41 0.43
42 0.33
43 0.26
44 0.17
45 0.13
46 0.08
47 0.04
48 0.06
49 0.07
50 0.08
51 0.1
52 0.12
53 0.19
54 0.22
55 0.24
56 0.24