Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167ZRT9

Protein Details
Accession A0A167ZRT9    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-34LGPGTHKRNQKGRRIGRRAVRAABasic
NLS Segment(s)
PositionSequence
18-29KRNQKGRRIGRR
Subcellular Location(s) mito 10, extr 7, E.R. 4, plas 3, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAVLPVVMTPELGPGTHKRNQKGRRIGRRAVRAAVDVCAEAVWLPVVVVVVLLLLLNGTRQDGHGSCYCAMETTTPDEQRTVRKGLQSFGMKCSSPVEELFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.21
3 0.27
4 0.33
5 0.38
6 0.48
7 0.56
8 0.64
9 0.7
10 0.75
11 0.8
12 0.82
13 0.83
14 0.81
15 0.82
16 0.75
17 0.68
18 0.58
19 0.5
20 0.43
21 0.36
22 0.28
23 0.18
24 0.14
25 0.1
26 0.09
27 0.06
28 0.05
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.04
48 0.07
49 0.07
50 0.11
51 0.13
52 0.16
53 0.16
54 0.17
55 0.17
56 0.14
57 0.15
58 0.12
59 0.11
60 0.14
61 0.19
62 0.2
63 0.21
64 0.22
65 0.24
66 0.29
67 0.32
68 0.32
69 0.3
70 0.35
71 0.36
72 0.36
73 0.42
74 0.44
75 0.42
76 0.41
77 0.42
78 0.36
79 0.35
80 0.36
81 0.31
82 0.25