Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162J4R9

Protein Details
Accession A0A162J4R9    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
20-39SASRENRKKKGVKTKTRDETBasic
NLS Segment(s)
PositionSequence
23-33RENRKKKGVKT
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MDLDTIKKRISETMMSKSASASRENRKKKGVKTKTRDETIKELEEQRLAKEQAIGLMWMKLHDLRQQERDIAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.4
4 0.37
5 0.37
6 0.3
7 0.29
8 0.28
9 0.34
10 0.44
11 0.51
12 0.55
13 0.6
14 0.65
15 0.69
16 0.74
17 0.74
18 0.75
19 0.75
20 0.81
21 0.79
22 0.78
23 0.71
24 0.64
25 0.6
26 0.53
27 0.47
28 0.39
29 0.33
30 0.29
31 0.3
32 0.27
33 0.22
34 0.23
35 0.22
36 0.2
37 0.19
38 0.18
39 0.17
40 0.17
41 0.16
42 0.11
43 0.11
44 0.11
45 0.1
46 0.11
47 0.11
48 0.13
49 0.17
50 0.24
51 0.28
52 0.34
53 0.37