Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162MCV1

Protein Details
Accession A0A162MCV1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
20-45ASAARIKKNKKTSQTKFKVRCKRNLYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVGDIKQFIEICRRDDASAARIKKNKKTSQTKFKVRCKRNLYTLVLKDSDKADKLKQSLPPNLVCIEVNKKEKKKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.32
4 0.27
5 0.29
6 0.3
7 0.27
8 0.33
9 0.34
10 0.36
11 0.4
12 0.45
13 0.5
14 0.58
15 0.59
16 0.62
17 0.69
18 0.72
19 0.78
20 0.83
21 0.85
22 0.84
23 0.87
24 0.87
25 0.82
26 0.82
27 0.78
28 0.73
29 0.7
30 0.67
31 0.62
32 0.6
33 0.57
34 0.51
35 0.45
36 0.41
37 0.35
38 0.3
39 0.28
40 0.22
41 0.22
42 0.22
43 0.25
44 0.28
45 0.32
46 0.37
47 0.41
48 0.46
49 0.48
50 0.46
51 0.43
52 0.41
53 0.37
54 0.31
55 0.28
56 0.3
57 0.33
58 0.4
59 0.47
60 0.53