Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167M4Y0

Protein Details
Accession A0A167M4Y0   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
118-138YQNPWARRTDCKEQKTKQDEHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044053  AsaB-like  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Amino Acid Sequences MTAVSAQLDFIKPLDIYTKEKPYQLFLAKPKSRQDVDLTNVEVDTVPNIPLHDVRGREDDFRIDEHGFQYIKHDQTFRAFDDPQRVNDEFLPQVVKVIKDHIPCAERVHVYDWRVIVYQNPWARRTDCKEQKTKQDEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.24
4 0.29
5 0.38
6 0.38
7 0.41
8 0.41
9 0.4
10 0.44
11 0.43
12 0.43
13 0.42
14 0.5
15 0.51
16 0.55
17 0.57
18 0.57
19 0.53
20 0.49
21 0.48
22 0.43
23 0.43
24 0.42
25 0.37
26 0.3
27 0.29
28 0.26
29 0.21
30 0.14
31 0.11
32 0.07
33 0.06
34 0.07
35 0.07
36 0.08
37 0.08
38 0.11
39 0.13
40 0.13
41 0.15
42 0.2
43 0.21
44 0.21
45 0.21
46 0.2
47 0.18
48 0.18
49 0.19
50 0.15
51 0.14
52 0.13
53 0.15
54 0.13
55 0.12
56 0.15
57 0.16
58 0.17
59 0.18
60 0.18
61 0.16
62 0.2
63 0.23
64 0.2
65 0.21
66 0.2
67 0.2
68 0.28
69 0.29
70 0.27
71 0.3
72 0.29
73 0.26
74 0.26
75 0.27
76 0.19
77 0.18
78 0.18
79 0.12
80 0.14
81 0.14
82 0.14
83 0.12
84 0.15
85 0.19
86 0.19
87 0.21
88 0.23
89 0.24
90 0.24
91 0.27
92 0.28
93 0.25
94 0.25
95 0.28
96 0.28
97 0.28
98 0.3
99 0.26
100 0.23
101 0.23
102 0.21
103 0.2
104 0.17
105 0.24
106 0.27
107 0.31
108 0.31
109 0.34
110 0.37
111 0.42
112 0.48
113 0.51
114 0.56
115 0.61
116 0.7
117 0.73
118 0.81