Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162J2F3

Protein Details
Accession A0A162J2F3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-34LDNLKSKLKSLFKRKPKTENKPAEAAHydrophilic
NLS Segment(s)
PositionSequence
21-24KRKP
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MAGSSPDVLDNLKSKLKSLFKRKPKTENKPAEAATEPAAAEPTKTDEAPAAAPAPAAEAAGPAEPAEPAKPAEAPAQPAAPTPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.3
3 0.38
4 0.45
5 0.53
6 0.59
7 0.65
8 0.75
9 0.81
10 0.84
11 0.86
12 0.87
13 0.87
14 0.87
15 0.8
16 0.75
17 0.69
18 0.61
19 0.51
20 0.42
21 0.32
22 0.23
23 0.19
24 0.13
25 0.13
26 0.1
27 0.08
28 0.07
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.1
35 0.1
36 0.11
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.05
45 0.04
46 0.05
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.07
53 0.07
54 0.08
55 0.08
56 0.1
57 0.1
58 0.12
59 0.17
60 0.18
61 0.22
62 0.23
63 0.25
64 0.24