Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165FMF7

Protein Details
Accession A0A165FMF7    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
163-193NSRMKKYSGSGRRRKTSKPTKSYSKGMEKKRBasic
NLS Segment(s)
PositionSequence
164-193SRMKKYSGSGRRRKTSKPTKSYSKGMEKKR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MMLTEKYGGIATKDQAWQVLLEGKYKQDKQTVDEYIGNLDILYRYAEIDDEYAKLIHFKRGLNEKLAEKVFITESLPTTYAAACKAARKVTDLQDIHSRKTNIFKFISGSSGSGRRTEKDPDVMDIDQISPETHQKHSVVDSVTTAENHSGKTTSYAKTKTPNSRMKKYSGSGRRRKTSKPTKSYSKGMEKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.19
5 0.18
6 0.23
7 0.19
8 0.2
9 0.21
10 0.24
11 0.32
12 0.35
13 0.37
14 0.36
15 0.37
16 0.39
17 0.46
18 0.44
19 0.4
20 0.39
21 0.35
22 0.31
23 0.29
24 0.24
25 0.16
26 0.13
27 0.09
28 0.07
29 0.08
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.08
41 0.12
42 0.12
43 0.16
44 0.19
45 0.19
46 0.24
47 0.33
48 0.35
49 0.35
50 0.38
51 0.35
52 0.37
53 0.37
54 0.31
55 0.23
56 0.22
57 0.18
58 0.15
59 0.14
60 0.1
61 0.1
62 0.11
63 0.12
64 0.1
65 0.1
66 0.1
67 0.1
68 0.09
69 0.1
70 0.1
71 0.11
72 0.14
73 0.15
74 0.15
75 0.18
76 0.21
77 0.23
78 0.31
79 0.29
80 0.29
81 0.36
82 0.37
83 0.35
84 0.36
85 0.32
86 0.24
87 0.32
88 0.33
89 0.29
90 0.28
91 0.27
92 0.25
93 0.25
94 0.26
95 0.19
96 0.17
97 0.14
98 0.16
99 0.17
100 0.18
101 0.19
102 0.19
103 0.21
104 0.24
105 0.25
106 0.28
107 0.28
108 0.26
109 0.29
110 0.27
111 0.24
112 0.21
113 0.18
114 0.12
115 0.12
116 0.1
117 0.07
118 0.11
119 0.13
120 0.14
121 0.17
122 0.17
123 0.19
124 0.2
125 0.23
126 0.21
127 0.19
128 0.18
129 0.17
130 0.17
131 0.16
132 0.15
133 0.14
134 0.13
135 0.13
136 0.14
137 0.13
138 0.12
139 0.17
140 0.2
141 0.21
142 0.28
143 0.3
144 0.33
145 0.4
146 0.49
147 0.54
148 0.6
149 0.66
150 0.68
151 0.74
152 0.75
153 0.73
154 0.71
155 0.66
156 0.67
157 0.68
158 0.7
159 0.7
160 0.76
161 0.8
162 0.78
163 0.81
164 0.81
165 0.82
166 0.82
167 0.82
168 0.81
169 0.82
170 0.84
171 0.84
172 0.82
173 0.83