Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165BWK5

Protein Details
Accession A0A165BWK5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPCSHNCAPPKKNWRNRELDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, golg 5, mito 4, E.R. 3
Family & Domain DBs
Amino Acid Sequences MPCSHNCAPPKKNWRNRELDVLLSGILLLCCKVPMSPCDSFPKVRNVRISHADSDSWKGASQRPARQSLLDSERRVKQNTFVTPGMWSMPLRDILNIIFGSEIRKIDDLSAARAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.79
5 0.7
6 0.61
7 0.52
8 0.44
9 0.34
10 0.25
11 0.21
12 0.11
13 0.08
14 0.06
15 0.05
16 0.04
17 0.04
18 0.05
19 0.06
20 0.07
21 0.1
22 0.16
23 0.17
24 0.2
25 0.27
26 0.3
27 0.32
28 0.33
29 0.41
30 0.4
31 0.42
32 0.47
33 0.42
34 0.44
35 0.48
36 0.48
37 0.4
38 0.37
39 0.34
40 0.27
41 0.27
42 0.23
43 0.17
44 0.15
45 0.13
46 0.15
47 0.22
48 0.28
49 0.31
50 0.34
51 0.38
52 0.39
53 0.38
54 0.37
55 0.35
56 0.36
57 0.35
58 0.34
59 0.34
60 0.39
61 0.41
62 0.43
63 0.37
64 0.37
65 0.38
66 0.4
67 0.41
68 0.36
69 0.33
70 0.31
71 0.31
72 0.26
73 0.2
74 0.16
75 0.12
76 0.14
77 0.16
78 0.16
79 0.16
80 0.15
81 0.14
82 0.17
83 0.15
84 0.13
85 0.1
86 0.1
87 0.12
88 0.14
89 0.15
90 0.14
91 0.15
92 0.15
93 0.16
94 0.22
95 0.21