Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165ARF8

Protein Details
Accession A0A165ARF8    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-49WYPPCRFHLRRDIRIRTVKGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 11.833, nucl 9.5, cyto_pero 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
Amino Acid Sequences LPIEVWENGINHLWDDQRALRRCSLVCRAWYPPCRFHLRRDIRIRTVKGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.18
4 0.24
5 0.28
6 0.3
7 0.29
8 0.31
9 0.31
10 0.34
11 0.36
12 0.3
13 0.29
14 0.3
15 0.34
16 0.39
17 0.46
18 0.46
19 0.45
20 0.47
21 0.54
22 0.53
23 0.55
24 0.59
25 0.6
26 0.66
27 0.7
28 0.73
29 0.73
30 0.8