Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CZV4

Protein Details
Accession A0A165CZV4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23RENRKRGRKHKKPKEELSQAGHQBasic
NLS Segment(s)
PositionSequence
4-14RKRGRKHKKPK
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences RENRKRGRKHKKPKEELSQAGHQEVVAREADYETQAVPSWIVSAPAQSEVGRDAPFRCADSEVKAYFRTVDMQICEWQEQSGAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.87
4 0.82
5 0.79
6 0.69
7 0.59
8 0.49
9 0.38
10 0.31
11 0.25
12 0.2
13 0.12
14 0.11
15 0.1
16 0.1
17 0.11
18 0.08
19 0.09
20 0.07
21 0.07
22 0.07
23 0.07
24 0.06
25 0.05
26 0.06
27 0.05
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.08
34 0.07
35 0.07
36 0.08
37 0.1
38 0.1
39 0.1
40 0.1
41 0.13
42 0.14
43 0.15
44 0.15
45 0.16
46 0.17
47 0.2
48 0.25
49 0.23
50 0.25
51 0.24
52 0.24
53 0.22
54 0.21
55 0.2
56 0.17
57 0.2
58 0.2
59 0.22
60 0.25
61 0.27
62 0.27
63 0.24
64 0.22