Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165IIU0

Protein Details
Accession A0A165IIU0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPQSHHydrophilic
NLS Segment(s)
PositionSequence
14-59KKAHRNGIKKPQSHRTRSMKGVDPKFRRNAKYALVGSRKARKEAKE
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPQSHRTRSMKGVDPKFRRNAKYALVGSRKARKEAKESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.79
7 0.83
8 0.81
9 0.77
10 0.75
11 0.75
12 0.74
13 0.71
14 0.71
15 0.69
16 0.65
17 0.64
18 0.63
19 0.61
20 0.6
21 0.62
22 0.63
23 0.6
24 0.61
25 0.65
26 0.67
27 0.62
28 0.58
29 0.54
30 0.49
31 0.52
32 0.49
33 0.49
34 0.48
35 0.49
36 0.52
37 0.56
38 0.55
39 0.53
40 0.56
41 0.53