Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165H6S7

Protein Details
Accession A0A165H6S7   
Localization Confidence High
Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSPKRASASSPSRKRKLTKEEEDSRDEYHydrophilic
39-67EDIPSEKKKVEKPASKRRASKKAKVEEDEBasic
70-94EEESTSKKGKKTQVRSKAKSKAKADHydrophilic
NLS Segment(s)
PositionSequence
45-62KKKVEKPASKRRASKKAK
76-92KKGKKTQVRSKAKSKAK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004808  AP_endonuc_1  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004518  F:nuclease activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
PROSITE View protein in PROSITE  
PS51435  AP_NUCLEASE_F1_4  
CDD cd09087  Ape1-like_AP-endo  
Amino Acid Sequences MSPKRASASSPSRKRKLTKEEEDSRDEYSDLTEEESLPEDIPSEKKKVEKPASKRRASKKAKVEEDEESEEESTSKKGKKTQVRSKAKSKAKADVSEEEEEEKEGETTSNKQPTNKVLPVHISFPPRAPGTIRIASWNVSGLAAAEKKGFRYYLEAEDPDLLILTETKVGNEPVNPLLSKRFSHRYWSISSTKGYAGTAILSKTKPLSVSTELPGHPDPTSVKGRILTLEFETCYVVGTYVVNAGRGLKTLDAKNEWNKHFTAYIRALDAKKPVIWGGDLNVAPTEKDLSNPKPNWNKTAGYTEAETSAFARILEGTDEEGEDSTSEEKFVDIWRELHPDTRHYTYFSYRFNCRMKGIGWRLDMFVVSARLVEKVRLCEIRSEIYGASDHCPVILEIEGEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.82
4 0.82
5 0.82
6 0.82
7 0.85
8 0.83
9 0.82
10 0.74
11 0.66
12 0.56
13 0.46
14 0.36
15 0.27
16 0.22
17 0.16
18 0.16
19 0.14
20 0.13
21 0.14
22 0.16
23 0.15
24 0.13
25 0.13
26 0.12
27 0.13
28 0.18
29 0.21
30 0.24
31 0.26
32 0.32
33 0.38
34 0.48
35 0.57
36 0.61
37 0.67
38 0.74
39 0.81
40 0.84
41 0.87
42 0.87
43 0.87
44 0.87
45 0.86
46 0.85
47 0.85
48 0.85
49 0.8
50 0.74
51 0.69
52 0.65
53 0.61
54 0.51
55 0.43
56 0.34
57 0.3
58 0.26
59 0.21
60 0.17
61 0.18
62 0.22
63 0.23
64 0.3
65 0.4
66 0.5
67 0.6
68 0.69
69 0.74
70 0.8
71 0.84
72 0.87
73 0.87
74 0.86
75 0.84
76 0.77
77 0.76
78 0.71
79 0.7
80 0.65
81 0.61
82 0.57
83 0.51
84 0.47
85 0.4
86 0.33
87 0.27
88 0.23
89 0.17
90 0.12
91 0.09
92 0.09
93 0.09
94 0.14
95 0.2
96 0.27
97 0.28
98 0.31
99 0.34
100 0.4
101 0.47
102 0.46
103 0.41
104 0.37
105 0.41
106 0.4
107 0.4
108 0.37
109 0.32
110 0.29
111 0.29
112 0.3
113 0.25
114 0.24
115 0.22
116 0.23
117 0.26
118 0.28
119 0.27
120 0.26
121 0.26
122 0.26
123 0.24
124 0.21
125 0.14
126 0.11
127 0.1
128 0.08
129 0.1
130 0.09
131 0.09
132 0.11
133 0.11
134 0.12
135 0.14
136 0.14
137 0.11
138 0.16
139 0.18
140 0.21
141 0.24
142 0.23
143 0.23
144 0.23
145 0.22
146 0.17
147 0.14
148 0.08
149 0.05
150 0.05
151 0.05
152 0.07
153 0.07
154 0.07
155 0.09
156 0.1
157 0.1
158 0.11
159 0.12
160 0.11
161 0.12
162 0.12
163 0.12
164 0.15
165 0.16
166 0.17
167 0.19
168 0.24
169 0.24
170 0.31
171 0.34
172 0.34
173 0.35
174 0.39
175 0.38
176 0.34
177 0.34
178 0.28
179 0.25
180 0.22
181 0.18
182 0.13
183 0.1
184 0.09
185 0.09
186 0.08
187 0.09
188 0.09
189 0.09
190 0.09
191 0.1
192 0.1
193 0.1
194 0.14
195 0.15
196 0.18
197 0.19
198 0.23
199 0.22
200 0.24
201 0.24
202 0.21
203 0.17
204 0.16
205 0.15
206 0.16
207 0.2
208 0.18
209 0.18
210 0.18
211 0.18
212 0.19
213 0.19
214 0.16
215 0.13
216 0.14
217 0.13
218 0.12
219 0.12
220 0.1
221 0.1
222 0.08
223 0.06
224 0.05
225 0.05
226 0.05
227 0.08
228 0.08
229 0.08
230 0.08
231 0.09
232 0.09
233 0.09
234 0.1
235 0.09
236 0.12
237 0.14
238 0.17
239 0.19
240 0.23
241 0.31
242 0.38
243 0.38
244 0.37
245 0.35
246 0.34
247 0.34
248 0.3
249 0.29
250 0.25
251 0.25
252 0.24
253 0.28
254 0.27
255 0.27
256 0.29
257 0.24
258 0.21
259 0.21
260 0.19
261 0.16
262 0.16
263 0.14
264 0.13
265 0.17
266 0.16
267 0.16
268 0.16
269 0.15
270 0.14
271 0.14
272 0.15
273 0.09
274 0.12
275 0.18
276 0.23
277 0.33
278 0.36
279 0.44
280 0.51
281 0.54
282 0.56
283 0.55
284 0.5
285 0.44
286 0.48
287 0.42
288 0.34
289 0.33
290 0.28
291 0.26
292 0.23
293 0.2
294 0.15
295 0.13
296 0.11
297 0.09
298 0.09
299 0.08
300 0.08
301 0.09
302 0.09
303 0.09
304 0.09
305 0.09
306 0.09
307 0.09
308 0.09
309 0.08
310 0.08
311 0.08
312 0.08
313 0.08
314 0.07
315 0.07
316 0.08
317 0.11
318 0.15
319 0.15
320 0.18
321 0.2
322 0.26
323 0.27
324 0.33
325 0.33
326 0.33
327 0.36
328 0.4
329 0.38
330 0.35
331 0.38
332 0.39
333 0.43
334 0.45
335 0.45
336 0.44
337 0.51
338 0.53
339 0.54
340 0.48
341 0.46
342 0.41
343 0.46
344 0.49
345 0.49
346 0.47
347 0.45
348 0.43
349 0.4
350 0.38
351 0.28
352 0.24
353 0.18
354 0.14
355 0.13
356 0.13
357 0.15
358 0.16
359 0.19
360 0.2
361 0.23
362 0.3
363 0.33
364 0.34
365 0.37
366 0.4
367 0.41
368 0.38
369 0.36
370 0.3
371 0.27
372 0.28
373 0.24
374 0.23
375 0.21
376 0.19
377 0.16
378 0.17
379 0.15
380 0.15
381 0.15