Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4WFL6

Protein Details
Accession J4WFL6    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-42GGALKLKGAKVDKKKKKRRAKTDLEKNLATBasic
NLS Segment(s)
PositionSequence
16-36LKLKGAKVDKKKKKRRAKTDL
48-58PSKELVKKKRK
97-99KKR
Subcellular Location(s) nucl 19.5, cyto_nucl 15, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDDYALSGGGGGALKLKGAKVDKKKKKRRAKTDLEKNLATGEGASPSKELVKKKRKEGEEEDGQAAEDRRQVEEEDDVAPVQKTESERQYEEAKKKRLLKMAEKSGSRPELLKTHKERVEQLNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.09
6 0.13
7 0.19
8 0.29
9 0.38
10 0.49
11 0.59
12 0.7
13 0.81
14 0.86
15 0.91
16 0.93
17 0.94
18 0.93
19 0.94
20 0.94
21 0.94
22 0.94
23 0.88
24 0.77
25 0.66
26 0.56
27 0.45
28 0.33
29 0.22
30 0.13
31 0.1
32 0.1
33 0.1
34 0.09
35 0.09
36 0.13
37 0.17
38 0.23
39 0.3
40 0.4
41 0.46
42 0.55
43 0.62
44 0.62
45 0.65
46 0.66
47 0.64
48 0.61
49 0.57
50 0.49
51 0.41
52 0.37
53 0.3
54 0.24
55 0.16
56 0.12
57 0.09
58 0.09
59 0.1
60 0.1
61 0.1
62 0.1
63 0.11
64 0.09
65 0.09
66 0.08
67 0.08
68 0.08
69 0.07
70 0.06
71 0.07
72 0.09
73 0.13
74 0.17
75 0.2
76 0.21
77 0.24
78 0.31
79 0.36
80 0.43
81 0.47
82 0.49
83 0.52
84 0.59
85 0.62
86 0.62
87 0.62
88 0.63
89 0.64
90 0.68
91 0.68
92 0.62
93 0.59
94 0.59
95 0.54
96 0.45
97 0.37
98 0.3
99 0.32
100 0.36
101 0.42
102 0.42
103 0.49
104 0.53
105 0.54
106 0.57
107 0.57
108 0.61
109 0.54
110 0.5
111 0.5
112 0.46
113 0.44
114 0.4
115 0.32
116 0.25
117 0.24
118 0.24
119 0.23
120 0.24
121 0.3
122 0.34
123 0.35