Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165F6K1

Protein Details
Accession A0A165F6K1    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
128-154DDSIAHKCWRVRKRNYFKQPGTRIVCSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, nucl 13, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR027145  PWP2  
Amino Acid Sequences MIPSNKSRTFPFESRKNNAAIALNPDSNGLVSVDEDGRALPVNFRRRIVLHHSRFHKPVKSINSLQMRSSSHFHTKTFSGHRDIVVNTYFFANGKIVRLTYYSLKAKPPEEMNSDDSLNFITSSSALDDSIAHKCWRVRKRNYFKQPGTRIVCSTFHRPSNLRQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.67
3 0.63
4 0.55
5 0.51
6 0.44
7 0.37
8 0.35
9 0.33
10 0.29
11 0.27
12 0.26
13 0.23
14 0.19
15 0.18
16 0.11
17 0.07
18 0.07
19 0.08
20 0.08
21 0.08
22 0.08
23 0.07
24 0.08
25 0.09
26 0.08
27 0.11
28 0.18
29 0.26
30 0.29
31 0.3
32 0.32
33 0.31
34 0.36
35 0.41
36 0.45
37 0.43
38 0.49
39 0.53
40 0.55
41 0.59
42 0.6
43 0.55
44 0.47
45 0.48
46 0.47
47 0.49
48 0.46
49 0.5
50 0.52
51 0.48
52 0.46
53 0.43
54 0.38
55 0.33
56 0.33
57 0.29
58 0.28
59 0.29
60 0.28
61 0.27
62 0.26
63 0.28
64 0.31
65 0.29
66 0.27
67 0.26
68 0.26
69 0.25
70 0.24
71 0.22
72 0.18
73 0.15
74 0.11
75 0.1
76 0.1
77 0.08
78 0.09
79 0.07
80 0.07
81 0.08
82 0.08
83 0.08
84 0.09
85 0.1
86 0.11
87 0.13
88 0.18
89 0.21
90 0.22
91 0.26
92 0.28
93 0.28
94 0.3
95 0.31
96 0.3
97 0.3
98 0.32
99 0.32
100 0.31
101 0.31
102 0.27
103 0.23
104 0.19
105 0.16
106 0.12
107 0.08
108 0.06
109 0.06
110 0.07
111 0.08
112 0.08
113 0.07
114 0.07
115 0.08
116 0.1
117 0.14
118 0.15
119 0.14
120 0.17
121 0.21
122 0.3
123 0.39
124 0.47
125 0.55
126 0.64
127 0.75
128 0.83
129 0.9
130 0.92
131 0.9
132 0.91
133 0.88
134 0.86
135 0.82
136 0.75
137 0.67
138 0.6
139 0.57
140 0.51
141 0.52
142 0.49
143 0.46
144 0.49
145 0.49