Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165C524

Protein Details
Accession A0A165C524    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-33AQRTSCARCSRPRKRSASRASTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011258  BPG-indep_PGM_N  
IPR036646  PGAM_B_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0030145  F:manganese ion binding  
GO:0004619  F:phosphoglycerate mutase activity  
GO:0006007  P:glucose catabolic process  
Pfam View protein in Pfam  
PF06415  iPGM_N  
Amino Acid Sequences MIGLGWWRALAQRTSCARCSRPRKRSASRASTSTSSSIARHIAPRSAGGYVKELLAFIEKEKHGQIATAVGRYYAMDRDKRQWERIKIAVDDLVKGLGQKGRTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.47
4 0.49
5 0.55
6 0.63
7 0.66
8 0.68
9 0.74
10 0.79
11 0.82
12 0.87
13 0.87
14 0.86
15 0.79
16 0.73
17 0.68
18 0.6
19 0.52
20 0.43
21 0.34
22 0.26
23 0.22
24 0.2
25 0.17
26 0.16
27 0.18
28 0.17
29 0.17
30 0.16
31 0.17
32 0.16
33 0.16
34 0.16
35 0.13
36 0.14
37 0.12
38 0.12
39 0.11
40 0.09
41 0.08
42 0.09
43 0.08
44 0.07
45 0.11
46 0.11
47 0.13
48 0.13
49 0.14
50 0.12
51 0.12
52 0.12
53 0.13
54 0.14
55 0.14
56 0.13
57 0.12
58 0.13
59 0.13
60 0.14
61 0.13
62 0.16
63 0.21
64 0.24
65 0.32
66 0.41
67 0.46
68 0.53
69 0.58
70 0.6
71 0.62
72 0.64
73 0.62
74 0.53
75 0.51
76 0.47
77 0.39
78 0.33
79 0.26
80 0.21
81 0.16
82 0.15
83 0.16
84 0.15