Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165I5E8

Protein Details
Accession A0A165I5E8    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-37SSSTPSRTLSRKAKRPERVYTDVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, extr 3, nucl 2, cyto 2, cyto_nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
Amino Acid Sequences MPPTWRSTGSGPAGSSSTPSRTLSRKAKRPERVYTDVVLTIQPKYAILIAQREKNHEFRSYQRRADVKRLWLYESAPTCAITCVVETSAPKTPGQLRDSAGVGNDAFNAHEKTSYAYPIRSLYIVSPLITRNVCGCGTGCFLLWVFATLVGNSLKSIRWRAWCVCSDGLEFAAGHCCVTVVDRTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.22
4 0.2
5 0.2
6 0.22
7 0.25
8 0.29
9 0.38
10 0.46
11 0.53
12 0.59
13 0.67
14 0.75
15 0.8
16 0.83
17 0.84
18 0.82
19 0.78
20 0.72
21 0.64
22 0.56
23 0.47
24 0.4
25 0.32
26 0.24
27 0.18
28 0.15
29 0.13
30 0.11
31 0.11
32 0.11
33 0.1
34 0.11
35 0.19
36 0.21
37 0.27
38 0.29
39 0.33
40 0.36
41 0.4
42 0.41
43 0.37
44 0.36
45 0.38
46 0.47
47 0.49
48 0.48
49 0.49
50 0.53
51 0.53
52 0.59
53 0.56
54 0.53
55 0.53
56 0.52
57 0.47
58 0.42
59 0.39
60 0.35
61 0.32
62 0.25
63 0.2
64 0.19
65 0.17
66 0.15
67 0.15
68 0.09
69 0.07
70 0.06
71 0.06
72 0.07
73 0.07
74 0.09
75 0.13
76 0.14
77 0.14
78 0.15
79 0.19
80 0.24
81 0.25
82 0.25
83 0.22
84 0.22
85 0.23
86 0.21
87 0.17
88 0.12
89 0.11
90 0.08
91 0.07
92 0.06
93 0.06
94 0.07
95 0.08
96 0.07
97 0.08
98 0.08
99 0.1
100 0.11
101 0.15
102 0.14
103 0.13
104 0.15
105 0.16
106 0.16
107 0.14
108 0.14
109 0.11
110 0.14
111 0.15
112 0.14
113 0.14
114 0.13
115 0.17
116 0.16
117 0.16
118 0.13
119 0.15
120 0.14
121 0.14
122 0.13
123 0.12
124 0.15
125 0.15
126 0.14
127 0.11
128 0.12
129 0.12
130 0.11
131 0.1
132 0.08
133 0.09
134 0.09
135 0.08
136 0.1
137 0.1
138 0.1
139 0.09
140 0.1
141 0.11
142 0.14
143 0.19
144 0.22
145 0.28
146 0.34
147 0.38
148 0.44
149 0.45
150 0.47
151 0.46
152 0.43
153 0.39
154 0.34
155 0.3
156 0.24
157 0.2
158 0.15
159 0.17
160 0.15
161 0.13
162 0.11
163 0.11
164 0.1
165 0.12