Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165C9W4

Protein Details
Accession A0A165C9W4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-46AEGGIVKKRKHKSKSKEKEKEKEKEEDKBasic
NLS Segment(s)
PositionSequence
21-43GGIVKKRKHKSKSKEKEKEKEKE
Subcellular Location(s) nucl 19.5, cyto_nucl 14.333, mito_nucl 11.832, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSHYDFRPGGALKLRGGVAEGGIVKKRKHKSKSKEKEKEKEKEEDKVAEAERLKELESALKVEEAKSGSPSGSGRSSPVVSSSSDRKTAAERRFEEVQKKRLAAKVAKLANQTHKDRVHEFNSKLEALSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.24
4 0.2
5 0.13
6 0.13
7 0.14
8 0.13
9 0.17
10 0.21
11 0.22
12 0.31
13 0.4
14 0.47
15 0.55
16 0.63
17 0.69
18 0.77
19 0.87
20 0.89
21 0.91
22 0.92
23 0.92
24 0.92
25 0.9
26 0.83
27 0.81
28 0.73
29 0.7
30 0.63
31 0.55
32 0.47
33 0.42
34 0.38
35 0.33
36 0.3
37 0.24
38 0.22
39 0.19
40 0.18
41 0.15
42 0.14
43 0.13
44 0.12
45 0.12
46 0.11
47 0.12
48 0.11
49 0.11
50 0.13
51 0.1
52 0.1
53 0.1
54 0.1
55 0.09
56 0.1
57 0.1
58 0.1
59 0.11
60 0.11
61 0.1
62 0.12
63 0.12
64 0.11
65 0.12
66 0.11
67 0.11
68 0.14
69 0.18
70 0.19
71 0.2
72 0.21
73 0.2
74 0.25
75 0.32
76 0.35
77 0.39
78 0.39
79 0.42
80 0.47
81 0.5
82 0.54
83 0.53
84 0.54
85 0.5
86 0.49
87 0.48
88 0.46
89 0.49
90 0.44
91 0.43
92 0.45
93 0.44
94 0.46
95 0.47
96 0.47
97 0.5
98 0.53
99 0.51
100 0.5
101 0.5
102 0.51
103 0.52
104 0.53
105 0.51
106 0.52
107 0.5
108 0.48
109 0.48
110 0.44
111 0.4
112 0.34
113 0.29
114 0.23
115 0.26
116 0.24
117 0.22
118 0.23
119 0.25
120 0.24