Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165I6I3

Protein Details
Accession A0A165I6I3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-36TSSSGGKAAKKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
12-30SGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences QAKAKGAPTSSSGGKAAKKKKWSKGKVKDKAQHAVILDKPTFDRIMKEVPTFRFISQSILIERLKINGSLARVAIAHLEKEGLIKRIVHHSGQLIYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.44
4 0.47
5 0.56
6 0.62
7 0.7
8 0.77
9 0.82
10 0.84
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.83
17 0.8
18 0.7
19 0.63
20 0.52
21 0.47
22 0.39
23 0.36
24 0.29
25 0.23
26 0.21
27 0.19
28 0.2
29 0.15
30 0.14
31 0.12
32 0.16
33 0.17
34 0.19
35 0.21
36 0.21
37 0.24
38 0.24
39 0.22
40 0.21
41 0.19
42 0.21
43 0.18
44 0.19
45 0.16
46 0.19
47 0.18
48 0.17
49 0.17
50 0.15
51 0.15
52 0.13
53 0.13
54 0.12
55 0.13
56 0.13
57 0.13
58 0.12
59 0.11
60 0.11
61 0.14
62 0.12
63 0.11
64 0.1
65 0.1
66 0.1
67 0.13
68 0.16
69 0.14
70 0.15
71 0.16
72 0.19
73 0.27
74 0.3
75 0.29
76 0.29
77 0.31