Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DLT9

Protein Details
Accession A0A165DLT9    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-29SSSPYGRTHVWKHRQRKLPPPFVPQFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences RSVSSSPYGRTHVWKHRQRKLPPPFVPQFPQRVTRADGSTFTQYTTSPRSEVLLTRDTTNNPLWNASKWVAESEDEDEVTGRLGRFNRRFDGLGGFDMDMEFLNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.75
4 0.82
5 0.82
6 0.84
7 0.84
8 0.84
9 0.81
10 0.8
11 0.76
12 0.71
13 0.69
14 0.63
15 0.59
16 0.51
17 0.51
18 0.43
19 0.41
20 0.39
21 0.38
22 0.35
23 0.29
24 0.28
25 0.25
26 0.27
27 0.24
28 0.21
29 0.17
30 0.15
31 0.17
32 0.19
33 0.17
34 0.14
35 0.14
36 0.15
37 0.15
38 0.16
39 0.17
40 0.17
41 0.17
42 0.18
43 0.19
44 0.19
45 0.21
46 0.21
47 0.2
48 0.17
49 0.19
50 0.18
51 0.18
52 0.21
53 0.19
54 0.18
55 0.16
56 0.17
57 0.16
58 0.15
59 0.16
60 0.14
61 0.14
62 0.13
63 0.13
64 0.12
65 0.1
66 0.11
67 0.11
68 0.08
69 0.11
70 0.14
71 0.24
72 0.3
73 0.35
74 0.38
75 0.4
76 0.41
77 0.39
78 0.43
79 0.35
80 0.31
81 0.28
82 0.24
83 0.21
84 0.19
85 0.18