Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165EPI5

Protein Details
Accession A0A165EPI5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRVLGHKRAKRNTRPNTSLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGRVLGHKRAKRNTRPNTSLVQIEGVSTKEEAQFYLGKRVAYVYRAKREIQGSKIRVMWGRVTRPHGNSGAVKAKFRSNLPPHAFGASVRVMLYPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.78
4 0.72
5 0.65
6 0.56
7 0.46
8 0.37
9 0.27
10 0.22
11 0.2
12 0.15
13 0.13
14 0.11
15 0.11
16 0.11
17 0.11
18 0.1
19 0.12
20 0.15
21 0.15
22 0.22
23 0.23
24 0.21
25 0.2
26 0.22
27 0.21
28 0.21
29 0.27
30 0.26
31 0.3
32 0.33
33 0.33
34 0.35
35 0.39
36 0.4
37 0.38
38 0.41
39 0.36
40 0.37
41 0.37
42 0.35
43 0.32
44 0.3
45 0.3
46 0.27
47 0.3
48 0.31
49 0.37
50 0.4
51 0.4
52 0.42
53 0.38
54 0.36
55 0.32
56 0.34
57 0.36
58 0.32
59 0.32
60 0.3
61 0.33
62 0.33
63 0.34
64 0.39
65 0.36
66 0.45
67 0.49
68 0.51
69 0.48
70 0.47
71 0.45
72 0.35
73 0.33
74 0.24
75 0.2
76 0.16
77 0.14
78 0.13