Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165AT23

Protein Details
Accession A0A165AT23    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
159-181LVSLKSAKWWKRRQPLLPSSPHPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR012908  PGAP1-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0016788  F:hydrolase activity, acting on ester bonds  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF07819  PGAP1  
Amino Acid Sequences MTRVPATSTPIVRAKVLCEKISEVYPGRSVHLIGHSMGGLDCRYLTTHLTDRPFKVLSVTTISTPHRGSSFADHFLATVGRERMPSVLALLDLLPNGGGDGKAFEFLTVENMRKFNEETPDVPGVKYFSWGAVYEPGLIDTWKWPHSVVLEKEGPNDGLVSLKSAKWWKRRQPLLPSSPHPDRSARRIRPASLERAMFGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.41
4 0.37
5 0.34
6 0.35
7 0.35
8 0.36
9 0.36
10 0.29
11 0.26
12 0.3
13 0.28
14 0.27
15 0.25
16 0.24
17 0.22
18 0.22
19 0.21
20 0.17
21 0.17
22 0.15
23 0.14
24 0.14
25 0.12
26 0.09
27 0.07
28 0.07
29 0.07
30 0.08
31 0.09
32 0.1
33 0.13
34 0.18
35 0.23
36 0.28
37 0.32
38 0.32
39 0.35
40 0.35
41 0.3
42 0.28
43 0.24
44 0.21
45 0.21
46 0.21
47 0.18
48 0.21
49 0.22
50 0.23
51 0.22
52 0.21
53 0.17
54 0.17
55 0.17
56 0.21
57 0.23
58 0.22
59 0.22
60 0.21
61 0.2
62 0.19
63 0.18
64 0.11
65 0.12
66 0.1
67 0.1
68 0.11
69 0.11
70 0.11
71 0.11
72 0.11
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.04
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.03
86 0.02
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.1
95 0.1
96 0.12
97 0.12
98 0.13
99 0.14
100 0.15
101 0.16
102 0.15
103 0.18
104 0.19
105 0.18
106 0.22
107 0.26
108 0.25
109 0.23
110 0.21
111 0.18
112 0.16
113 0.16
114 0.12
115 0.09
116 0.1
117 0.1
118 0.11
119 0.12
120 0.12
121 0.11
122 0.11
123 0.11
124 0.1
125 0.09
126 0.09
127 0.09
128 0.12
129 0.13
130 0.13
131 0.13
132 0.14
133 0.17
134 0.25
135 0.24
136 0.27
137 0.31
138 0.31
139 0.33
140 0.33
141 0.3
142 0.22
143 0.21
144 0.14
145 0.11
146 0.1
147 0.12
148 0.12
149 0.12
150 0.16
151 0.24
152 0.32
153 0.4
154 0.5
155 0.57
156 0.66
157 0.76
158 0.8
159 0.83
160 0.85
161 0.84
162 0.82
163 0.78
164 0.76
165 0.74
166 0.69
167 0.61
168 0.59
169 0.55
170 0.57
171 0.63
172 0.61
173 0.65
174 0.67
175 0.67
176 0.69
177 0.69
178 0.68
179 0.64
180 0.58