Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165AUV6

Protein Details
Accession A0A165AUV6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-49NNRFPRKRSRSPTAHRQRSRBasic
NLS Segment(s)
PositionSequence
35-49RKRSRSPTAHRQRSR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences PIGTCDVATQRSRTSLNTSIVRVQPGWTCNNRFPRKRSRSPTAHRQRSRPPNEVHRRQDSEFARGARYSSSNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.37
4 0.38
5 0.38
6 0.39
7 0.39
8 0.39
9 0.32
10 0.27
11 0.24
12 0.24
13 0.27
14 0.26
15 0.29
16 0.33
17 0.43
18 0.5
19 0.52
20 0.55
21 0.61
22 0.65
23 0.71
24 0.72
25 0.71
26 0.73
27 0.75
28 0.8
29 0.8
30 0.82
31 0.77
32 0.76
33 0.77
34 0.78
35 0.78
36 0.74
37 0.7
38 0.7
39 0.76
40 0.8
41 0.77
42 0.75
43 0.74
44 0.68
45 0.7
46 0.62
47 0.56
48 0.52
49 0.46
50 0.4
51 0.34
52 0.34
53 0.28