Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165GAE5

Protein Details
Accession A0A165GAE5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-128LRLAVPRLLQPRRRRRRKRRRRSVACACVPASHydrophilic
NLS Segment(s)
PositionSequence
106-118QPRRRRRRKRRRR
Subcellular Location(s) cyto 9, mito 8, extr 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
IPR044076  Ribosomal_P2  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002182  P:cytoplasmic translational elongation  
Pfam View protein in Pfam  
PF00428  Ribosomal_60s  
CDD cd05833  Ribosomal_P2  
Amino Acid Sequences MRYIAAYLLLQIGGNASPSADDVKKVLGAVGIESEDDRLGKLISELEGKDINELIAEGSSKLASVRPSHLFLRSPADSACVCRSLRVARSPYLRAVLRLAVPRLLQPRRRRRRKRRRRSVACACVPASAMLTTRAGGVRRGHGLRSVRLSWWEGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.07
6 0.12
7 0.11
8 0.12
9 0.12
10 0.13
11 0.14
12 0.14
13 0.13
14 0.1
15 0.1
16 0.1
17 0.1
18 0.08
19 0.08
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.07
29 0.07
30 0.08
31 0.1
32 0.1
33 0.12
34 0.14
35 0.14
36 0.14
37 0.13
38 0.12
39 0.09
40 0.09
41 0.07
42 0.05
43 0.05
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.08
51 0.1
52 0.14
53 0.16
54 0.19
55 0.2
56 0.22
57 0.21
58 0.21
59 0.25
60 0.21
61 0.2
62 0.17
63 0.18
64 0.16
65 0.17
66 0.17
67 0.14
68 0.14
69 0.13
70 0.15
71 0.16
72 0.2
73 0.23
74 0.25
75 0.26
76 0.3
77 0.32
78 0.31
79 0.33
80 0.3
81 0.25
82 0.23
83 0.21
84 0.2
85 0.21
86 0.2
87 0.17
88 0.17
89 0.2
90 0.26
91 0.31
92 0.36
93 0.44
94 0.54
95 0.64
96 0.75
97 0.83
98 0.86
99 0.91
100 0.95
101 0.96
102 0.97
103 0.97
104 0.96
105 0.96
106 0.95
107 0.94
108 0.88
109 0.82
110 0.71
111 0.6
112 0.5
113 0.4
114 0.3
115 0.2
116 0.15
117 0.12
118 0.12
119 0.11
120 0.12
121 0.14
122 0.14
123 0.18
124 0.2
125 0.23
126 0.29
127 0.31
128 0.31
129 0.35
130 0.39
131 0.4
132 0.44
133 0.42
134 0.37
135 0.39