Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165F0F6

Protein Details
Accession A0A165F0F6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MQPCPRIFRRQDQGRQQRYRKLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MQPCPRIFRRQDQGRQQRYRKLIVGFPSLLRQLLRNRHAGLARELLPSRSRPTAEMPWLGGGSSSVAVLDNTLDVCLAESSRMMDKSHPLARLQSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.86
4 0.84
5 0.78
6 0.74
7 0.68
8 0.6
9 0.55
10 0.49
11 0.48
12 0.4
13 0.36
14 0.33
15 0.29
16 0.26
17 0.22
18 0.2
19 0.22
20 0.29
21 0.31
22 0.32
23 0.33
24 0.35
25 0.37
26 0.36
27 0.32
28 0.27
29 0.25
30 0.24
31 0.23
32 0.21
33 0.2
34 0.19
35 0.19
36 0.18
37 0.17
38 0.16
39 0.21
40 0.24
41 0.25
42 0.25
43 0.23
44 0.21
45 0.21
46 0.19
47 0.14
48 0.09
49 0.07
50 0.06
51 0.05
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.08
68 0.13
69 0.14
70 0.15
71 0.17
72 0.22
73 0.29
74 0.34
75 0.34
76 0.32