Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0WF22

Protein Details
Accession G0WF22    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-128IGVFRKRTNLPKFKRKHDINNIKTPVTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG ndi:NDAI_0H02090  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MGDSEFPVKLGQIPISRRLSQEERNAEQLDADSRSIFVNNISIDMTPEQIESHFKEFGNHIVRITLFTDRHSKGCAYIEFDNVEVRELALNSNGTPFNGSVIGVFRKRTNLPKFKRKHDINNIKTPVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.41
4 0.39
5 0.44
6 0.45
7 0.46
8 0.52
9 0.52
10 0.49
11 0.52
12 0.52
13 0.45
14 0.39
15 0.33
16 0.27
17 0.2
18 0.18
19 0.13
20 0.12
21 0.12
22 0.12
23 0.11
24 0.09
25 0.1
26 0.09
27 0.1
28 0.1
29 0.09
30 0.1
31 0.11
32 0.11
33 0.08
34 0.08
35 0.08
36 0.08
37 0.1
38 0.11
39 0.13
40 0.15
41 0.14
42 0.15
43 0.16
44 0.22
45 0.24
46 0.22
47 0.19
48 0.18
49 0.18
50 0.18
51 0.18
52 0.15
53 0.11
54 0.13
55 0.19
56 0.2
57 0.21
58 0.21
59 0.2
60 0.18
61 0.22
62 0.21
63 0.19
64 0.19
65 0.2
66 0.19
67 0.19
68 0.19
69 0.15
70 0.15
71 0.1
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.08
79 0.11
80 0.11
81 0.1
82 0.11
83 0.11
84 0.1
85 0.1
86 0.1
87 0.08
88 0.11
89 0.16
90 0.16
91 0.18
92 0.18
93 0.23
94 0.28
95 0.37
96 0.45
97 0.51
98 0.58
99 0.67
100 0.74
101 0.79
102 0.85
103 0.84
104 0.84
105 0.85
106 0.87
107 0.85
108 0.87